KEGG   Homo sapiens (human): 3178Help
Entry
3178              CDS       T01001                                 

Gene name
HNRNPA1, ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, UP_1, hnRNP_A1, hnRNP-A1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3178 (HNRNPA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     3178 (HNRNPA1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     3178 (HNRNPA1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3178 (HNRNPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 HnRNPA1 RRM_7 Nup35_RRM_2 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 3178
NCBI-ProteinID: NP_112420
OMIM: 164017
HGNC: 5031
Ensembl: ENSG00000135486
Vega: OTTHUMG00000169702
Pharos: P09651(Tchem)
UniProt: P09651 A0A024RAZ7
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 372 aa AA seqDB search
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtcagagtctcctaaagagcccgaacagctgaggaagctcttcattggaggg
ttgagctttgaaacaactgatgagagcctgaggagccattttgagcaatggggaacgctc
acggactgtgtggtaatgagagatccaaacaccaagcgctccaggggctttgggtttgtc
acatatgccactgtggaggaggtggatgcagctatgaatgcaaggccacacaaggtggat
ggaagagttgtggaaccaaagagagctgtctccagagaagattctcaaagaccaggtgcc
cacttaactgtgaaaaagatatttgttggtggcattaaagaagacactgaagaacatcac
ctaagagattattttgaacagtatggaaaaattgaagtgattgaaatcatgactgaccga
ggcagtggcaagaaaaggggctttgcctttgtaacctttgacgaccatgactccgtggat
aagattgtcattcagaaataccatactgtgaatggccacaactgtgaagttagaaaagcc
ctgtcaaagcaagagatggctagtgcttcatccagccaaagaggtcgaagtggttctgga
aactttggtggtggtcgtggaggtggtttcggtgggaatgacaacttcggtcgtggagga
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggtaatgatggtggttatggaggaggcggccctggttac
tctggaggaagcagaggctatggaagtggtggacagggttatggaaaccagggcagtggc
tatggcgggagtggcagctatgacagctataacaacggaggcggaggcggctttggcggt
ggtagtggaagcaattttggaggtggtggaagctacaatgattttgggaattacaacaat
cagtcttcaaattttggacccatgaagggaggaaattttggaggcagaagctctggcccc
tatggcggtggaggccaatactttgcaaaaccacgaaaccaaggtggctatggcggttcc
agcagcagcagtagctatggcagtggcagaagattttaa

DBGET integrated database retrieval system