KEGG   Homo sapiens (human): 3178Help
Entry
3178              CDS       T01001                                 

Gene name
HNRNPA1, ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, hnRNP_A1, hnRNP-A1
Definition
heterogeneous nuclear ribonucleoprotein A1
Orthology
K12741  
heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.1
AA seq 320 aa AA seqDB search
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPR
NQGGYGGSSSSSSYGSGRRF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtcagagtctcctaaagagcccgaacagctgaggaagctcttcattggaggg
ttgagctttgaaacaactgatgagagcctgaggagccattttgagcaatggggaacgctc
acggactgtgtggtaatgagagatccaaacaccaagcgctccaggggctttgggtttgtc
acatatgccactgtggaggaggtggatgcagctatgaatgcaaggccacacaaggtggat
ggaagagttgtggaaccaaagagagctgtctccagagaagattctcaaagaccaggtgcc
cacttaactgtgaaaaagatatttgttggtggcattaaagaagacactgaagaacatcac
ctaagagattattttgaacagtatggaaaaattgaagtgattgaaatcatgactgaccga
ggcagtggcaagaaaaggggctttgcctttgtaacctttgacgaccatgactccgtggat
aagattgtcattcagaaataccatactgtgaatggccacaactgtgaagttagaaaagcc
ctgtcaaagcaagagatggctagtgcttcatccagccaaagaggtcgaagtggttctgga
aactttggtggtggtcgtggaggtggtttcggtgggaatgacaacttcggtcgtggagga
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggtaatgatggaagcaattttggaggtggtggaagctac
aatgattttgggaattacaacaatcagtcttcaaattttggacccatgaagggaggaaat
tttggaggcagaagctctggcccctatggcggtggaggccaatactttgcaaaaccacga
aaccaaggtggctatggcggttccagcagcagcagtagctatggcagtggcagaagattt
taa

DBGET integrated database retrieval system