KEGG   Homo sapiens (human): 318Help
Entry
318               CDS       T01001                                 

Gene name
NUDT2, APAH1
Definition
nudix (nucleoside diphosphate linked moiety X)-type motif 2 (EC:3.6.1.17)
Orthology
K01518  
bis(5'-nucleosidyl)-tetraphosphatase [EC:3.6.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    318 (NUDT2)
   00240 Pyrimidine metabolism
    318 (NUDT2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.17  bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
     318 (NUDT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 147 aa AA seqDB search
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQ
EEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLE
EACQLAQFKEMKAALQEGHQFLCSIEA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccttgagagcatgtggcttgatcatcttccgaagatgcctcattcccaaagtggac
aacaatgcaattgagtttttactgctgcaggcatcagatggcattcatcactggactcct
cccaaaggccatgtggaaccaggagaggatgacttggaaacagccctgagggagacccaa
gaggaagcaggcatagaagcaggccagctgaccattattgaggggttcaaaagggaactc
aattatgtggccaggaacaagcctaaaacagtcatttactggctggcggaggtgaaggac
tatgacgtggagatccgcctctcccatgagcaccaagcctaccgctggctggggctggag
gaggcctgccagttggctcagttcaaggagatgaaggcagcgctccaagaaggacaccag
tttctttgctccatagaggcctga

DBGET integrated database retrieval system