KEGG   Homo sapiens (human): 3183Help
Entry
3183              CDS       T01001                                 

Gene name
HNRNPC, C1, C2, HNRNP, HNRPC, SNRPC
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein C (C1/C2)
  KO
K12884  
heterogeneous nuclear ribonucleoprotein C1/C2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3183 (HNRNPC)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3183 (HNRNPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P07910(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 306 aa AA seqDB search
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSS
SFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQR
GSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSS
SVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSA
NGEDDS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgttaccaacaagacagatcctcgctccatgaactcccgtgtattcatt
gggaatctcaacactcttgtggtcaagaaatctgatgtggaggcaatcttttcgaagtat
ggcaaaattgtgggctgctctgttcataagggctttgccttcgttcagtatgttaatgag
agaaatgcccgggctgctgtagcaggagaggatggcagaatgattgctggccaggtttta
gatattaacctggctgcagagccaaaagtgaaccgaggaaaagcaggtgtgaaacgatct
gcagcggagatgtacgggtcagtaacagaacacccttctccgtcccctctactcagctcc
tcttttgacttggactatgactttcaacgggactattatgataggatgtacagttaccca
gcacgtgtacctcctcctcctcctattgctcgggctgtagtgccctcgaaacgtcagcgt
gtatcaggaaacacttcacgaaggggcaaaagtggcttcaattctaagagtggacagcgg
ggatcttccaagtctggaaagttgaaaggagatgaccttcaggccattaagaaggagctg
acccagataaaacaaaaagtggattctctcctggaaaacctggaaaaaattgaaaaggaa
cagagcaaacaagcagtagagatgaagaatgataagtcagaagaggagcagagcagcagc
tccgtgaagaaagatgagactaatgtgaagatggagtctgaggggggtgcagatgactct
gctgaggagggggacctactggatgatgatgataatgaagatcggggggatgaccagctg
gagttgatcaaggatgatgaaaaagaggctgaggaaggagaggatgacagagacagcgcc
aatggcgaggatgactcttaa

DBGET integrated database retrieval system