KEGG   Homo sapiens (human): 3184Help
Entry
3184              CDS       T01001                                 

Gene name
HNRNPD, AUF1, AUF1A, HNRPD, P37, hnRNPD0
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein D
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    3184 (HNRNPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 CBFNT RRM_3 Nup35_RRM_2 NID
Motif
Other DBs
NCBI-GeneID: 3184
NCBI-ProteinID: NP_112738
OMIM: 601324
HGNC: 5036
Ensembl: ENSG00000138668
Vega: OTTHUMG00000130290
Pharos: Q14103(Tbio)
UniProt: Q14103 A0A024RDF3
Structure
PDB: 

Jmol
Position
4q21.22
AA seq 355 aa AA seqDB search
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGS
AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKF
GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagcagttcggcggggacggggcggcggcagcggcaacggcggcggtaggc
ggctcggcgggcgagcaggagggagccatggtggcggcgacacagggggcagcggcggcg
gcgggaagcggagccgggaccgggggcggaaccgcgtctggaggcaccgaagggggcagc
gccgagtcggagggggcgaagattgacgccagtaagaacgaggaggatgaaggccattca
aactcctccccacgacactctgaagcagcgacggcacagcgggaagaatggaaaatgttt
ataggaggccttagctgggacactacaaagaaagatctgaaggactacttttccaaattt
ggtgaagttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggtttt
ggctttgtgctatttaaagaatcggagagtgtagataaggtcatggatcaaaaagaacat
aaattgaatgggaaggtgattgatcctaaaagggccaaagccatgaaaacaaaagagccg
gttaaaaaaatttttgttggtggcctttctccagatacacctgaagagaaaataagggag
tactttggtggttttggtgaggtggaatccatagagctccccatggacaacaagaccaat
aagaggcgtgggttctgctttattacctttaaggaagaagaaccagtgaagaagataatg
gaaaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaag
gaacaatatcagcaacagcaacagtggggatctagaggaggatttgcaggaagagctcgt
ggaagaggtggtggccccagtcaaaactggaaccagggatatagtaactattggaatcaa
ggctatggcaactatggatataacagccaaggttacggtggttatggaggatatgactac
actggttacaacaactactatggatatggtgattatagcaaccagcagagtggttatggg
aaggtatccaggcgaggtggtcatcaaaatagctacaaaccatactaa

DBGET integrated database retrieval system