KEGG   Homo sapiens (human): 319Help
Entry
319               CDS       T01001                                 

Gene name
APOF, Apo-F, LTIP
Definition
(RefSeq) apolipoprotein F
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.3
AA seq 326 aa AA seqDB search
MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSS
DPLSCQFLHPKSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNAT
QVLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVH
NVVQLLPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGGPMGLA
ISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTTLASFISEV
VSSAPYWGWAIIKSYDLDPGAGSLEI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactggactgtgtgggtactctgctccagacatgcgtggcctcagactcatcatgata
ccagttgagctgctactttgctacctcctgctgcaccctgtggatgccacttcatatgga
aagcagacaaatgtcttgatgcactttcccttgtccttggaatcccagacaccctcctca
gaccccttgtcctgccaatttctgcacccaaagtcactgcctggtttcagccacatggcc
cctctacccaagttcttggtaagcctggctctaaggaatgccctggaggaagctggttgt
caggctgatgtttgggctctacagctacagctctaccgccagggtggtgtgaatgctaca
caggtcctcatccagcatcttcgagggctccagaaaggcagaagcacagagaggaacgtg
tcagtggaagccctggcctctgctctgcagctgttagccagggagcagcaaagcacagga
agggtcgggcgctccctcccgacagaggactgtgagaatgagaaggagcaagctgtgcac
aatgtagtccagctgctgccaggagtgggaaccttctacaacctgggcacagctttgtat
tatgctactcaaaactgcctgggcaaggccagggaacgaggccgagatggggccatagat
ctgggatatgaccttctgatgaccatggctgggatgtcaggggggcctatgggtctagcg
atcagtgctgcacttaaacctgcattaaggtctggggttcagcagttgatccagtattac
caagatcagaaagacgcaaacatctctcagccggagaccaccaaggagggtttgagggcc
atctcagatgtgagtgacttggaagaaacaactactctggcttctttcatatcagaagta
gtaagttcagctccctactgggggtgggccataatcaagagctatgacttagatcctggg
gctgggagtcttgagatataa

DBGET integrated database retrieval system