KEGG   Homo sapiens (human): 3190Help
Entry
3190              CDS       T01001                                 

Gene name
HNRNPK, CSBP, HNRPK, TUNP
Definition
heterogeneous nuclear ribonucleoprotein K
Orthology
K12886  
heterogeneous nuclear ribonucleoprotein K
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Viral carcinogenesis
MicroRNAs in cancer
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.32-q21.33
AA seq 464 aa AA seqDB search
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaacagccagaagaaaccttccctaacactgaaaccaatggtgaatttggt
aaacgccctgcagaagatatggaagaggaacaagcatttaaaagatctagaaacactgat
gagatggttgaattacgcattctgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatattgagtatcagtgctgatattgaaacaattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacactataaagga
agtgactttgactgcgagttgaggctgttgattcatcagagtctagcaggaggaattatt
ggggtcaaaggtgctaaaatcaaagaacttcgagagaacactcaaaccaccatcaagctt
ttccaggaatgctgtcctcattccactgacagagttgttcttattggaggaaaacccgat
agggttgtagagtgcataaagatcatccttgatcttatatctgagtctcccatcaaagga
cgtgcacagccttatgatcccaatttttacgatgaaacctatgattatggtggttttaca
atgatgtttgatgaccgtcgcggacgcccagtgggatttcccatgcggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccatctagaagagattat
gatgatatgagccctcgtcgaggaccacctccccctcctcccggacgaggcggccggggt
ggtagcagagctcggaatcttcctcttcctccaccaccaccacctagagggggagacctc
atggcctatgacagaagagggagacctggagaccgttacgacggcatggttggtttcagt
gctgatgaaacttgggactctgcaatagatacatggagcccatcagaatggcagatggct
tatgaaccacagggtggctccggatatgattattcctatgcagggggtcgtggctcatat
ggtgatcttggtggacctattattactacacaagtaactattcccaaagatttggctgga
tctattattggcaaaggtggtcagcggattaaacaaatccgtcatgagtcgggagcttcg
atcaaaattgatgagcctttagaaggatccgaagatcggatcattaccattacaggaaca
caggaccagatacagaatgcacagtatttgctgcagaacagtgtgaagcagtatgcagat
gttgaaggattctaa

DBGET integrated database retrieval system