KEGG   Homo sapiens (human): 319100Help
Entry
319100            CDS       T01001                                 

Gene name
TAAR6, TA4, TAR4, TAR6, TRAR4, taR-4, taR-6
Definition
(RefSeq) trace amine associated receptor 6
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    319100 (TAAR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Trace amine
    319100 (TAAR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 319100
NCBI-ProteinID: NP_778237
OMIM: 608923
HGNC: 20978
Ensembl: ENSG00000146383
Vega: OTTHUMG00000015579
Pharos: Q96RI8(Tbio)
UniProt: Q96RI8
Position
6q23.2
AA seq 345 aa AA seqDB search
MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHF
KQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSL
FHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEEL
SDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTES
SSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA
YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaattcatccctgctggtggctgtgcagctgtgctacgcgaacgtgaatggg
tcctgtgtgaaaatccccttctcgccgggatcccgggtgattctgtacatagtgtttggc
tttggggctgtgctggctgtgtttggaaacctcctggtgatgatttcaatcctccatttc
aagcagctgcactctccgaccaattttctcgttgcctctctggcctgcgctgatttcttg
gtgggtgtgactgtgatgcccttcagcatggtcaggacggtggagagctgctggtatttt
gggaggagtttttgtactttccacacctgctgtgatgtggcattttgttactcttctctc
tttcacttgtgcttcatctccatcgacaggtacattgcggttactgaccccctggtctat
cctaccaagttcaccgtatctgtgtcaggaatttgcatcagcgtgtcctggatcctgccc
ctcatgtacagcggtgctgtgttctacacaggtgtctatgacgatgggctggaggaatta
tctgatgccctaaactgtataggaggttgtcagaccgttgtaaatcaaaactgggtgttg
acagattttctatccttctttatacctacctttattatgataattctgtatggtaacata
tttcttgtggctagacgacaggcgaaaaagatagaaaatactggtagcaagacagaatca
tcctcagagagttacaaagccagagtggccaggagagagagaaaagcagctaaaaccctg
ggggtcacagtggtagcatttatgatttcatggttaccatatagcattgattcattaatt
gatgcctttatgggctttataacccctgcctgtatttatgagatttgctgttggtgtgct
tattataactcagccatgaatcctttgatttatgctttattttacccatggtttaggaaa
gcaataaaagttattgtaactggtcaggttttaaagaacagttcagcaaccatgaatttg
ttttctgaacatatataa

DBGET integrated database retrieval system