KEGG   Homo sapiens (human): 32Help
Entry
32                CDS       T01001                                 

Gene name
ACACB, ACC2, ACCB, HACC275
Definition
acetyl-CoA carboxylase beta (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Adipocytokine signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:hsa00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.11
AA seq 2458 aa AA seqDB search
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQR
NGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
GTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSV
AGSSRESTRKGSRASLGALSLEAYLTTGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAIRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIAARITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEESVRYMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAVKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLSTMDSPAST
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctttgtctatcttgtctgattttctcctgtctgaccttttcctggtta
aaaatctgggggaaaatgacggactccaagccgatcaccaagagtaaatcagaagcaaac
ctcatcccgagccaggagccctttccagcctctgataactcaggggagacaccgcagaga
aatggggagggccacactctgcccaagacacccagccaggccgagccagcctcccacaaa
ggccccaaagatgccggtcggcggagaaactccctaccaccctcccaccagaagccccca
agaaaccccctttcttccagtgacgcagcaccctccccagagcttcaagccaacgggact
gggacacaaggtctggaggccacagataccaatggcctgtcctcctcagccaggccccag
ggccagcaagctggctccccctccaaagaagacaagaagcaggcaaacatcaagaggcag
ctgatgaccaacttcatcctgggctcttttgatgactactcctccgacgaggactctgtt
gctggctcatctcgtgagtctacccggaagggcagccgggccagcttgggggccctgtcc
ctggaggcttatctgaccacaggtgaagctgagacccgcgtccccactatgaggccgagc
atgtcgggactccacctggtgaagaggggacgggaacacaagaagctggacctgcacaga
gactttaccgtggcttctcccgctgagtttgtcacacgctttgggggggatcgggtcatc
gagaaggtgcttattgccaacaacgggattgccgccgtgaagtgcatgcgctccatccgc
aggtgggcctatgagatgttccgcaacgagcgggccatccggtttgttgtgatggtgacc
cccgaggaccttaaggccaacgcagagtacatcaagatggcggatcattacgtccccgtc
ccaggagggcccaataacaacaactatgccaacgtggagctgattgtggacattgccaag
agaatccccgtgcaggcggtgtgggctggctggggccatgcttcagaaaaccctaaactt
ccggagctgctgtgcaagaatggagttgctttcttaggccctcccagtgaggccatgtgg
gccttaggagataagatcgcctccaccgttgtcgcccagacgctacaggtcccaaccctg
ccctggagtggaagcggcctgacagtggagtggacagaagatgatctgcagcagggaaaa
agaatcagtgtcccagaagatgtttatgacaagggttgcgtgaaagacgtagatgagggc
ttggaggcagcagaaagaattggttttccattgatgatcaaagcttctgaaggtggcgga
gggaagggaatccggaaggctgagagtgcggaggacttcccgatccttttcagacaagta
cagagtgagatcccaggctcgcccatctttctcatgaagctggcccagcacgcccgtcac
ctggaagttcagatcctcgctgaccagtatgggaatgctgtgtctctgtttggtcgcgac
tgctccatccagcggcggcatcagaagatcgttgaggaagcaccggccaccatcgccccg
ctggccatattcgagttcatggagcagtgtgccatccgcctggccaagaccgtgggctat
gtgagtgcagggacagtggaatacctctatagtcaggatggcagcttccacttcttggag
ctgaatcctcgcttgcaggtggaacatccctgcacagaaatgattgctgatgttaatctg
ccggccgcccagctacagatcgccatgggcgtgccactgcaccggctgaaggatatccgg
cttctgtatggagagtcaccatggggagtgactcccatttcttttgaaaccccctcaaac
cctcccctcgcccgaggccacgtcattgccgccagaatcaccagcgaaaacccagacgag
ggttttaagccgagctccgggactgtccaggaactgaatttccggagcagcaagaacgtg
tggggttacttcagcgtggccgctactggaggcctgcacgagtttgcggattcccaattt
gggcactgcttctcctggggagagaaccgggaagaggccatttcgaacatggtggtggct
ttgaaggaactgtccatccgaggcgactttaggactaccgtggaatacctcattaacctc
ctggagaccgagagcttccagaacaacgacatcgacaccgggtggttggactacctcatt
gctgagaaagtgcaggcggagaaaccggatatcatgcttggggtggtatgcggggccttg
aacgtggccgatgcgatgttcagaacgtgcatgacagatttcttacactccctggaaagg
ggccaggtcctcccagcggattcactactgaacctcgtagatgtggaattaatttacgga
ggtgttaagtacattctcaaggtggcccggcagtctctgaccatgttcgttctcatcatg
aatggctgccacatcgagattgatgcccaccggctgaatgatggggggctcctgctctcc
tacaatgggaacagctacaccacctacatgaaggaagaggttgacagttaccgaattacc
atcggcaataagacgtgtgtgtttgagaaggagaacgatcctacagtcctgagatccccc
tcggctgggaagctgacacagtacacagtggaggatgggggccacgttgaggctgggagc
agctacgctgagatggaggtgatgaagatgatcatgaccctgaacgttcaggaaagaggc
cgggtgaagtacatcaagcgtccaggtgccgtgctggaagcaggctgcgtggtggccagg
ctggagctcgatgacccttctaaagtccacccggctgaaccgttcacaggagaactccct
gcccagcagacactgcccatcctcggagagaaactgcaccaggtcttccacagcgtcctg
gaaaacctcaccaacgtcatgagtggcttttgtctgccagagcccgtttttagcataaag
ctgaaggagtgggtgcagaagctcatgatgaccctccggcacccgtcactgccgctgctg
gagctgcaggagatcatgaccagcgtggcaggccgcatccccgcccctgtggagaagtct
gtccgcagggtgatggcccagtatgccagcaacatcacctcggtgctgtgccagttcccc
agccagcagatagccaccatcctggactgccatgcagccaccctgcagcggaaggctgat
cgagaggtcttcttcatcaacacccagagcatcgtgcagttggtccagagataccgcagc
gggatccgcggctatatgaaaacagtggtgttggatctcctgagaagatacttgcgtgtt
gagcaccattttcagcaagcccactacgacaagtgtgtgataaacctcagggagcagttc
aagccagacatgtcccaggtgctggactgcatcttctcccacgcacaggtggccaagaag
aaccagctggtgatcatgttgatcgatgagctgtgtggcccagacccttccctgtcggac
gagctgatctccatcctcaacgagctcactcagctgagcaaaagcgagcactgcaaagtg
gccctcagagcccggcagatcctgattgcctcccacctcccctcctacgagctgcggcat
aaccaggtggagtccattttcctgtctgccattgacatgtacggccaccagttctgcccc
gagaacctcaagaaattaatactttcggaaacaaccatcttcgacgtcctgcctactttc
ttctatcacgcaaacaaagtcgtgtgcatggcgtccttggaggtttacgtgcggaggggc
tacatcgcctatgagttaaacagcctgcagcaccggcagctcccggacggcacctgcgtg
gtagaattccagttcatgctgccgtcctcccacccaaaccggatgaccgtgcccatcagc
atcaccaaccctgacctgctgaggcacagcacagagctcttcatggacagcggcttctcc
ccactgtgccagcgcatgggagccatggtagccttcaggagattcgaggacttcaccaga
aattttgatgaagtcatctcttgcttcgccaacgtgcccaaagacacccccctcttcagc
gaggcccgcacctccctatactccgaggatgactgcaagagcctcagagaagagcccatc
cacattctgaatgtgtccatccagtgtgcagaccacctggaggatgaggcactggtgccg
attttacggacattcgtacagtccaagaaaaatatccttgtggattatggactccgacga
atcacattcttgattgcccaagagaaagaatttcccaagtttttcacattcagagcaaga
gatgagtttgcagaagatcgcatttaccgtcacttggaacctgccctggccttccagctg
gaacttaaccggatgcgtaacttcgatctgaccgccgtgccctgtgccaaccacaagatg
cacctttacctgggtgctgccaaggtgaaggaaggtgtggaagtgacggaccataggttc
ttcatccgcgccatcatcaggcactctgacctgatcacaaaggaagcctccttcgaatac
ctgcagaacgagggtgagcggctgctcctggaggccatggacgagctggaggtggcgttc
aataacaccagcgtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtc
atcatggaccccttcaagatcgaggagtccgtgcgctacatggttatgcgctacggcagc
cggctgtggaaactccgtgtgctacaggctgaggtcaagatcaacatccgccagaccacc
accggcagtgccgttcccatccgcctgttcatcaccaatgagtcgggctactacctggac
atcagcctctacaaagaagtgactgactccagatctggaaatatcatgtttcactccttc
ggcaacaagcaagggccccagcacgggatgctgatcaatactccctacgtcaccaaggat
ctgctccaggccaagcgattccaggcccagaccctgggaaccacctacatctatgacttc
ccggaaatgttcaggcaggctctctttaaactgtggggctccccagacaagtatcccaaa
gacatcctgacatacactgaattagtgttggactctcagggccagctggtggagatgaac
cgacttcctggtggaaatgaggtgggcatggtggccttcaaaatgaggtttaagacccag
gagtacccggaaggacgggatgtgatcgtcatcggcaatgacatcacctttcgcattgga
tcctttggccctggagaggaccttctgtacctgcgggcatccgagatggcccgggcagag
ggcattcccaaaatttacgtggcagccaacagtggcgcccgtattggcatggcagaggag
atcaaacacatgttccacgtggcttgggtggacccagaagacccccacaaaggatttaaa
tacctgtacctgactccccaagactacaccagaatcagctccctgaactccgtccactgt
aaacacatcgaggaaggaggagagtccagatacatgatcacggatatcatcgggaaggat
gatggcttgggcgtggagaatctgaggggctcaggcatgattgctggggagtcctctctg
gcttacgaagagatcgtcaccattagcttggtgacctgccgagccattgggattggggcc
tacttggtgaggctgggccagcgagtgatccaggtggagaattcccacatcatcctcaca
ggagcaagtgctctcaacaaggtcctgggaagagaggtctacacatccaacaaccagctg
ggtggcgttcagatcatgcattacaatggtgtctcccacatcaccgtgccagatgacttt
gagggggtttataccatcctggagtggctgtcctatatgccaaaggataatcacagccct
gtccctatcatcacacccactgaccccattgacagagaaattgaattcctcccatccaga
gctccctacgacccccggtggatgcttgcaggaaggcctcacccaactctgaagggaacg
tggcagagcggattctttgaccacggcagtttcaaggaaatcatggcaccctgggcgcag
accgtggtgacaggacgagcaaggcttggggggattcccgtgggagtgattgctgtggag
acacggactgtggaggtggcagtccctgcagaccctgccaacctggattctgaggccaag
ataattcagcaggcaggacaggtgtggttcccagactcagcctacaaaaccgcccaggcc
gtcaaggacttcaaccgggagaagttgcccctgatgatctttgccaactggagggggttc
tccggtggcatgaaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggac
ggccttagacaatacaaacagcccatcctgatctatatcccgccctatgcggagctccgg
ggaggctcctgggtggtcatagatgccaccatcaacccgctgtgcatagaaatgtatgca
gacaaagagagcaggggtggtgttctggaaccagaggggacagtggagattaagttccga
aagaaagatctgataaagtccatgagaaggatcgatccagcttacaagaagctcatggaa
cagctaggggaacctgatctctccgacaaggaccgaaaggacctggagggccggctaaag
gctcgcgaggacctgctgctccccatctaccaccaggtggcggtgcagttcgccgacttc
catgacacacccggccggatgctggagaagggcgtcatatctgacatcctggagtggaag
accgcacgcaccttcctgtattggcgtctgcgccgcctcctcctggaggaccaggtcaag
caggagatcctgcaggccagcggggagctgagtcacgtgcatatccagtccatgctgcgt
cgctggttcgtggagacggagggggctgtcaaggcctacttgtgggacaacaaccaggtg
gttgtgcagtggctggaacagcactggcaggcaggggatggcccgcgctccaccatccgt
gagaacatcacgtacctgaagcacgactctgtcctcaagaccatccgaggcctggttgaa
gaaaaccccgaggtggccgtggactgtgtgatatacctgagccagcacatcagcccagct
gagcgggcgcaggtcgttcacctgctgtctaccatggacagcccggcctccacctga

DBGET integrated database retrieval system