KEGG   Homo sapiens (human): 320Help
Entry
320               CDS       T01001                                 

Gene name
APBA1, D9S411E, LIN10, MINT1, X11, X11A, X11ALPHA
Definition
(RefSeq) amyloid beta precursor protein binding family A member 1
  KO
K04531  
amyloid beta A4 precursor protein-binding family A member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.12
AA seq 837 aa AA seqDB search
MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPQQQHYVGRHQRGRALEDL
RAQLGQEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAV
QYRPEAEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGED
EPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDEAAAYRQEALGARLHHYDE
RSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDL
ERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEV
KTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGDSPSPGSSSPLGAESSSTSLH
PSDPVEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKN
VRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDH
PLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLI
AQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIE
KQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLS
TCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERG
GVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacttggaggggtctgcggaggtggaggtgaccgacgaggcggcaggtggggag
gtgaacgagtcggtggaggccgacctggagcaccccgaggtggaagaggaacagcagcag
ccgccgcagcagcagcactatgtgggccgccaccagcgcgggcgagccctcgaggacctc
cgcgcccagctcggccaggaggaagaggagcgcggggaatgcctggcgcgctcagccagc
acggagagcggcttccacaaccacacggacaccgccgagggcgacgtgatcgccgcggcc
cgcgacggctacgatgcggagcgcgcgcaggaccccgaggacgagagcgcctatgctgtg
cagtaccggcccgaggccgaggagtacacggagcaggcagaggccgagcacgccgaggcc
acgcaccgccgcgcgctgcccaaccacctgcacttccactcgctggagcacgaggaagcc
atgaatgcggcctactcaggctacgtctacacgcaccggctcttccaccgcggtgaggac
gagccctactccgagccctatgccgactacggcggcctccaggagcacgtgtacgaggag
ataggggacgcgcccgagctggacgcacgcgacggcctgcggctctacgagcaggagcgc
gacgaggcggccgcgtaccgccaggaggccctgggcgcgcggctgcaccattacgacgag
cgctccgacggcgagtccgacagccccgagaaggaggccgagttcgcgccctacccgcgc
atggacagctacgagcaggaggaggacatcgaccagatagtggccgaggtgaagcagagc
atgagctcgcagagcctcgacaaggcagccgaggacatgcctgaggccgagcaggacctg
gagcgtccccctaccccggccgggggtcgccccgacagccccgggctgcaggcgccggcg
gggcagcagcgggcggtgggccccgcgggcggcggcgaggcggggcagcggtacagcaag
gagaagcgcgatgccatctcgctggccatcaaggacatcaaggaggccatcgaggaggtg
aaaaccaggaccatccgttcgccttacacccccgacgagcccaaagagcccatctgggtc
atgcgccaggacattagccccaccagggactgtgacgaccagaggccgatggacggagat
tctccgtctcctggcagctcctcccccttgggtgcagagtcatcaagcacatctcttcac
cccagtgaccctgtggaagcgtccactaataaagagtcaagaaaaagcttggcttcattc
ccaacctacgttgaagttccgggaccctgcgaccccgaagacttgatcgatggaatcatt
tttgccgccaattaccttggctccactcagctgctctcagacaaaactccttccaaaaac
gtgcgcatgatgcaggcccaggaagccgtaagcaggatcaagatggcccagaaattagcc
aaaagcaggaagaaggctcctgaaggcgaatctcagccaatgactgaagtggatctcttc
atttctacccagagaatcaaagtgctgaacgccgacacacaggagacaatgatggaccac
cctctgaggaccatttcctacattgcggacattgggaacatcgttgtgctgatggcccgc
cggcggatgcctcgctccaactcccaggagaacgtggaagcgtcccacccatcccaggat
gggaaaaggcagtacaagatgatctgccacgtcttcgagtctgaggatgctcagctgatt
gcacagtccatcggacaggcatttagcgtggcataccaggaattcctcagggccaatggg
attaaccccgaagatctcagccagaaggagtatagtgacctgctcaatacccaggacatg
tacaacgatgacctgatccacttctccaagtcggaaaactgtaaagatgttttcatagag
aagcagaaaggagaaatcctaggtgtggtgattgtggagtctggctggggatccatcctc
cccaccgtgatcattgccaacatgatgcatggtggccctgcggagaaatctgggaagctg
aatatcggtgaccagatcatgtccattaatggcaccagcctggtgggcctgcctctgtcc
acctgccagagcattattaagggcttaaagaatcagtcccgagtcaagctgaatatcgtg
agatgtcctccggtgaccaccgtgttaatcagaagaccagaccttcgctaccagctcggt
ttcagcgtccagaatggaattatctgcagcctcatgcgagggggaatagctgagagagga
ggcgtccgtgtggggcaccggatcattgaaatcaatggacagagcgtcgtggccaccccc
cacgagaagatcgtccacattctctccaatgctgttggggagattcatatgaagacaatg
ccagccgcgatgtacaggctgctgacggcccaggagcagcctgtttacatctga

DBGET integrated database retrieval system