KEGG   Homo sapiens (human): 3207Help
Entry
3207              CDS       T01001                                 

Gene name
HOXA11, HOX1, HOX1I, RUSAT1
Definition
(RefSeq) homeobox A11
  KO
K09296  
homeobox protein HoxA/C/D11
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00867  
Radioulnar synostosis with amegakaryocytic thrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3207 (HOXA11)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3207 (HOXA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.2
AA seq 313 aa AA seqDB search
MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREV
TFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTP
AVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAA
AAATGAPATSSSDSGGGGGCRETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQR
TRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKIN
RDRLQYYSANPLL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggattttgatgagcgtggtccctgctcctctaacatgtatttgccaagttgtacttac
tacgtctcgggtccagatttctccagcctcccttcttttctgccccagaccccgtcttcg
cgcccaatgacatactcctactcctccaacctgccccaggtccaacccgtgcgcgaagtg
accttcagagagtacgccattgagcccgccactaaatggcacccccgcggcaatctggcc
cactgctactccgcggaggagctcgtgcacagagactgcctgcaggcgcccagcgcggcc
ggcgtgcctggcgacgtgctggccaagagctcggccaacgtctaccaccaccccaccccc
gcagtctcgtccaatttctatagcaccgtgggcaggaacggcgtcctgccacaggctttc
gaccagtttttcgagacagcctacggcaccccggaaaacctcgcctcctccgactacccc
ggggacaagagcgccgagaaggggcccccggcggccacggcgacctccgcggcggcggcg
gcggctgcaacgggcgcgccggcaacttcaagttcggacagcggcggcggcggcggctgc
cgggagacggcggcggcagcagaggagaaagagcggcggcggcgccccgagagcagcagc
agccccgagtcgtcttccggccacactgaggacaaggccggcggctccagtggccaacgc
acccgcaaaaagcgctgcccctataccaagtaccagatccgagagctggaacgggagttc
ttcttcagcgtctacattaacaaagagaagcgcctgcaactgtcccgcatgctcaacctc
actgatcgtcaagtcaaaatctggtttcagaacaggagaatgaaggaaaaaaaaattaac
agagaccgtttacagtactactcagcaaatccactcctctaa

DBGET integrated database retrieval system