KEGG   Homo sapiens (human): 321Help
Entry
321               CDS       T01001                                 

Gene name
APBA2, D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11-BETA, X11L
Definition
(RefSeq) amyloid beta precursor protein binding family A member 2
  KO
K20055  
amyloid beta A4 precursor protein-binding family A member 2
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    321 (APBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q11-q12
AA seq 749 aa AA seqDB search
MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEE
YLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQ
EEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMT
SITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGF
KPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGP
CEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSAS
QDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQ
KEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANM
MNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTV
LIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQAL
SNSVGEIHMKTMPAAMFRLLTGQETPLYI
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccggaagcttgagagcgtggggagcggcatgttggaccatagggtgagacca
ggtcctgtccctcacagccaggagcccgagagcgaggacatggagctgcccttggagggc
tatgtgcccgagggcctggagctggctgccctgcggccagagagccccgcgccagaggaa
caggagtgccacaaccacagccccgatggggactccagctctgactacgtgaacaacacc
tctgaggaggaggactatgacgagggcctccctgaggaggaggagggcatcacctactac
atccgctactgccctgaggacgacagctacctagagggcatggactgcaacggggaggag
tacctggcccacagtgcacaccctgtggacactgatgagtgccaggaggcggtggaggag
tggacggactcggcgggcccgcacccccacggccacgaggctgaaggcagccaggactac
ccagacggccaactgcccattccggaggatgagccctccgtccttgaggcccatgaccag
gaagaagatggtcactactgtgccagcaaagagggctaccaggactactaccccgaggag
gccaacgggaacaccggcgcctccccctaccgcctgaggcgtggggatggggacctggag
gaccaggaggaggacattgaccagatcgtggcagagatcaagatgagtctgagcatgacc
agcatcaccagcgccagtgaggccagccccgagcatgggcctgagccagggcctgaggac
tctgtagaggcctgcccacccatcaaggccagctgcagccccagcaggcacgaggcgagg
cccaagtcgctgaacctccttcccgaggccaagcaccccggagacccccagagaggcttc
aagcccaagaccaggaccccagaagagaggctgaagtggccccacgagcaggtttgcaat
ggtctggagcagccaaggaagcagcagcgctctgatctcaatggacctgttgacaataac
aacattccagagacaaagaaggtggcatcatttccaagttttgtggctgttccagggccc
tgcgaaccagaagacctcatcgacgggatcatctttgctgccaattacctggggtccacc
cagctgctatcagaacggaacccttccaaaaacatcagaatgatgcaagcgcaggaggcc
gtcagccgggtcaagaggatgcaaaaggctgctaagatcaagaaaaaagcgaattctgag
ggggatgcccagacgctgacggaagtggacctcttcatttccacccagaggatcaaggtt
ttaaatgcagacacgcaggaaaccatgatggaccacgccttgcgtaccatctcctacatc
gccgacattgggaacattgtagtgctgatggccagacgccgcatgccccggtcagcctct
caggactgcatcgagaccacgcccggggcccaggaaggcaagaagcagtataagatgatc
tgccatgtgttcgagtcggaggatgcccagctcatcgcccagtctatcggccaggccttc
agcgtggcctaccaggagttcctgcgagccaatggcatcaaccccgaagacttgagccag
aaggaatacagcgacatcatcaacacccaggagatgtacaacgacgacctcatccacttc
tcaaactcggagaactgcaaggagctgcagctggagaagcacaagggcgagatcctgggc
gtggtggtggtggagtcgggctggggctccatcctgcccacggtgatcctggccaacatg
atgaatggcggcccggctgcccgctcggggaagctgagcatcggggaccagatcatgtcc
atcaatggcaccagcctggtggggctgcccctcgccacctgccaaggcatcatcaagggc
ctgaagaaccagacacaggtgaagctcaacattgtcagctgtcccccggtcaccacggtc
cttatcaagcggccagacctcaagtaccagctgggcttcagcgtgcagaatggaattatc
tgcagcctcatgagagggggcattgctgagcgagggggcgtccgtgtgggccaccgcatc
atcgagatcaacgggcagagcgtggtggccacagcccacgagaagatagtccaagctctg
tccaactcggtcggagagatccacatgaagaccatgcccgccgccatgttcaggctcctc
acgggtcaggagaccccgctgtacatctag

DBGET integrated database retrieval system