KEGG   Homo sapiens (human): 322Help
Entry
322               CDS       T01001                                 

Gene name
APBB1, FE65, MGC:9072, RIR
Definition
amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Orthology
K04529  
amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Class
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15
AA seq 710 aa AA seqDB search
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL
ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLP
EPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELV
QKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttccatcatcactgagccagtcggccattaatgccaacagccacggaggcccc
gcactgagcctacccctgcctctgcacgctgcccacaaccagctgctcaacgccaagctg
caggccacagctgtgggacccaaggacctgcgcagcgccatgggggagggtggtgggcct
gagccaggccctgccaatgccaagtggctaaaagagggccagaaccagctccggcgggcc
gccacggcccaccgtgaccagaatcgcaatgtgaccttgaccttggcggaggaggccagc
caggagcctgagatggcacccttgggccccaaaggcctgatacacctgtactctgagctg
gagctctcagctcacaacgcagccaaccgaggcctacgaggacctggcctgatcatcagc
actcaagagcaggggccagatgagggagaggagaaggcggccggggaggccgaggaggag
gaggaggatgatgatgatgaagaggaggaggaggacttatcttctcccccagggctgcct
gagcccctggagagtgtggaggcccctcccaggccccaagcccttacagatggcccccgg
gaacacagcaagagtgccagcctcctgtttggcatgcggaacagtgcagccagtgatgag
gactcaagctgggctaccttatcccagggcagcccctcctatggctccccagaggacaca
gattccttctggaaccccaacgccttcgagacggattccgacctgccggctggatggatg
agggtccaggacacctcagggacctattactggcacatcccaacagggaccacccagtgg
gaaccccccggccgggcctccccctcacaggggagcagcccccaagaggagtcccagctc
acctggacaggttttgctcatggagaaggctttgaggatggagaattttggaaggatgaa
cccagtgatgaggccccaatggagctgggactgaaggaacctgaggaggggacgttgacc
ttcccagctcagagcctcagcccagagccgttgccccaagaggaggagaagcttccccca
cggaataccaacccagggatcaagtgtttcgccgtgcgctccctaggctgggtagagatg
accgaggaggagctggcccctggacgcagcagtgtggcagtcaacaattgcatccgtcag
ctctcttaccacaaaaacaacctgcatgaccccatgtctgggggctggggggaaggaaag
gatctgctactgcagctggaggatgagacactaaagctagtggagccacagagccaggca
ctgctgcacgcccaacccatcatcagcatccgcgtgtggggcgtcgggcgggacagtgga
agagagagggactttgcctacgtagctcgtgataagctgacccagatgctcaagtgccac
gtgtttcgctgtgaggcacctgccaagaacatcgccaccagcctgcatgagatctgctct
aagatcatggccgaacggcgtaatgcccgctgcttggtaaatggactctccctggaccac
tctaaacttgtggatgtccctttccaagtggaattcccagcgcctaagaatgagttggtc
cagaagttccaagtctattacctggggaatgtacctgttgctaaacctgttggggtagat
gtgattaatggggccctcgagtcagtcctgtcctccagcagccgtgaacaatggacccca
agtcatgtcagtgtggcccctgctaccctcaccatcttgcaccagcagacagaggcagtg
ctgggagagtgtcgggtgcgtttcctctccttcctggccgtgggcagagatgtccacacg
tttgcattcatcatggctgccggcccagcctccttctgctgccacatgttctggtgcgag
cccaatgctgccagcctctcagaggctgtgcaggctgcgtgcatgcttcgctaccagaag
tgtctggatgcccgttcccaggcctccacctcctgcctcccagcaccccctgctgagtct
gtggcacggcgtgtagggtggactgtccgcaggggtgttcagtcgctgtggggctccctg
aagcccaaacggctgggggcccataccccatga

DBGET integrated database retrieval system