KEGG   Homo sapiens (human): 3224Help
Entry
3224              CDS       T01001                                 

Gene name
HOXC8, HOX3, HOX3A
Definition
(RefSeq) homeobox C8
  KO
K09308  
homeobox protein HoxB/C/D8
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3224 (HOXC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P31273(Tbio)
UniProt: 
Position
12q13.13
AA seq 242 aa AA seqDB search
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF
HHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANT
NSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRI
EVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN
KD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctacttcgtcaaccccctgttctccaaatacaaagccggcgagtccctggaa
ccggcctattacgactgccggttccctcagagcgtgggcaggagccatgcgctggtgtac
gggcccggcggctcggcgcccggcttccagcacgcttcgcaccacgttcaagacttcttc
caccacggcacctccggcatctccaactcaggctaccagcagaacccgtgctcgcttagc
tgccacggagacgcctccaaattctatggctacgaggcgctccccagacagtccctttat
ggggctcagcaagaggcgagcgtggtgcaatatcccgactgtaaatcctccgccaacact
aacagtagcgaaggacaaggccacttaaatcaaaactcgtctcccagcctcatgtttcca
tggatgagaccccacgctccggggaggcgcagtggacggcaaacttacagccggtatcag
accttggaactagaaaaggagtttctctttaatccttatttgacacgaaaacgtcggatt
gaagtctctcatgccctgggactgaccgagagacaagtgaagatctggttccagaaccga
aggatgaagtggaaaaaggagaacaacaaggataaactgccgggagcccgagatgaggag
aaggtggaggaagaaggaaatgaggaagaggagaaagaagaggaggaaaaggaagaaaac
aaggactaa

DBGET integrated database retrieval system