KEGG   Homo sapiens (human): 3236Help
Entry
3236              CDS       T01001                                 

Gene name
HOXD10, HOX4, HOX4D, HOX4E, Hox-4.4
Definition
(RefSeq) homeobox D10
  KO
K09295  
homrobox protein Hox-D10
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
MicroRNAs in cancer
Disease
H00929  
Congenital vertical talus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3236 (HOXD10)
   05205 Proteoglycans in cancer
    3236 (HOXD10)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3236 (HOXD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.1
AA seq 340 aa AA seqDB search
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
NPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagt
gcctgcaggagtgacagtttttattccagcagcgccagcatgtacatgccaccacctagc
gcagacatggggacctatggaatgcaaacctgtggactgctcccgtctctggccaaaaga
gaagtgaaccaccaaaatatgggtatgaatgtgcatccttatatacctcaagtagacagt
tggacagatccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccccact
tgctccttcaccaccaacattaaggaagaatccaattgctgcatgtattctgataagcgc
aacaaactcatttcggccgaggtcccttcgtaccagaggctggtccctgagtcttgtccc
gttgagaaccctgaggttcccgtccctggatattttagactgagtcagacctacgccacc
gggaaaacccaagagtacaataatagccccgaaggcagctccactgtcatgctccagctc
aaccctcgtggcgcggccaagccgcagctctccgctgcccagctgcagatggaaaagaag
atgaacgagcccgtgagcggccaggagcccaccaaagtctcccaggtggagagccccgag
gccaaaggcggccttcccgaagagaggagctgcctggctgaggtctccgtgtccagtccc
gaagtgcaggagaaggaaagcaaagaggaaatcaagtctgatacaccaaccagcaattgg
ctcactgcaaagagtggcagaaagaagaggtgcccttacactaagcaccaaacgctggaa
ttagaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagagatcagt
aagagcgttaacctcaccgacaggcaggtcaagatttggtttcaaaaccgccgaatgaaa
ctcaagaagatgagccgagagaaccggatccgagaactgaccgccaacctcacgttttct
tag

DBGET integrated database retrieval system