KEGG   Homo sapiens (human): 3242Help
Entry
3242              CDS       T01001                                 

Gene name
HPD, 4-HPPD, 4HPPD, GLOD3, HPPDASE, PPD
Definition
4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Disease
H00165  
Tyrosinemia
Drug target
Nitisinone: 
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hsa00360]
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:hsa00130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 354 aa AA seqDB search
MGFEPLAYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFE
VEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPG
YEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHT
EYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIR
HLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKP
VQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgaacctctagcctacaggggcctggagaccggttcccgggaggtggtcagc
catgtaatcaaacaagggaagattgtgtttgtcctctcctcagcgctcaacccctggaac
aaagagatgggcgatcacctggtgaaacacggtgacggagtgaaggacattgcgttcgag
gtggaagattgtgactacatcgtgcagaaagcacgggaacggggcgccaaaatcatgcgg
gagccctgggtagagcaagacaagtttgggaaggtgaagtttgctgtgctgcagacgtat
ggggacaccacacacaccctggtggagaagatgaactacatcggccaattcttgcctgga
tatgaggccccagcgttcatggaccccctacttcctaaactgcccaaatgcagtctggag
atgatcgaccacattgtgggaaaccagcctgatcaggagatggtgtccgcctccgaatgg
tacctgaaaaacctgcagttccaccgcttctggtccgtggatgacacgcaggtgcacacg
gaatatagctctctgcgatccattgtggtggccaactatgaagagtccatcaagatgccc
atcaatgagccagcgcctggcaagaagaagtcccagatccaggaatatgtggactataac
gggggcgctggggtccagcacatcgctctcaagaccgaagacatcatcacagcgattcgc
cacttgagagagagaggcctggagttcttatctgttccctccacgtactacaaacaactg
cgggagaagctgaagacggccaagatcaaggtgaaggagaacattgatgccctggaggag
ctgaaaatcctggtggactacgacgagaaaggctacctcctgcagatcttcaccaaaccg
gtgcaggaccggcccacgctcttcctggaagtcatccagcgccacaaccaccagggtttt
ggagccggcaacttcaactcactgttcaaggctttcgaggaggagcagaacctgcggggt
aacctcaccaacatggagaccaatggggtggtgcccggcatgtaa

DBGET integrated database retrieval system