KEGG   Homo sapiens (human): 3242Help
Entry
3242              CDS       T01001                                 

Gene name
HPD, 4-HPPD, 4HPPD, GLOD3, HPPDASE, PPD
Definition
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
  KO
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Disease
H00165  
Tyrosinemia
Drug target
Nitisinone: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    3242 (HPD)
   00360 Phenylalanine metabolism
    3242 (HPD)
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    3242 (HPD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     3242 (HPD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3242 (HPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 393 aa AA seqDB search
MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSH
VIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEM
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLR
EKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttacagtgacaaaggggcaaagcctgagagaggccgattcctccacttccac
tctgtgaccttctgggttggcaacgccaagcaggccgcgtcattctactgcagcaagatg
ggctttgaacctctagcctacaggggcctggagaccggttcccgggaggtggtcagccat
gtaatcaaacaagggaagattgtgtttgtcctctcctcagcgctcaacccctggaacaaa
gagatgggcgatcacctggtgaaacacggtgacggagtgaaggacattgcgttcgaggtg
gaagattgtgactacatcgtgcagaaagcacgggaacggggcgccaaaatcatgcgggag
ccctgggtagagcaagacaagtttgggaaggtgaagtttgctgtgctgcagacgtatggg
gacaccacacacaccctggtggagaagatgaactacatcggccaattcttgcctggatat
gaggccccagcgttcatggaccccctacttcctaaactgcccaaatgcagtctggagatg
atcgaccacattgtgggaaaccagcctgatcaggagatggtgtccgcctccgaatggtac
ctgaaaaacctgcagttccaccgcttctggtccgtggatgacacgcaggtgcacacggaa
tatagctctctgcgatccattgtggtggccaactatgaagagtccatcaagatgcccatc
aatgagccagcgcctggcaagaagaagtcccagatccaggaatatgtggactataacggg
ggcgctggggtccagcacatcgctctcaagaccgaagacatcatcacagcgattcgccac
ttgagagagagaggcctggagttcttatctgttccctccacgtactacaaacaactgcgg
gagaagctgaagacggccaagatcaaggtgaaggagaacattgatgccctggaggagctg
aaaatcctggtggactacgacgagaaaggctacctcctgcagatcttcaccaaaccggtg
caggaccggcccacgctcttcctggaagtcatccagcgccacaaccaccagggttttgga
gccggcaacttcaactcactgttcaaggctttcgaggaggagcagaacctgcggggtaac
ctcaccaacatggagaccaatggggtggtgcccggcatgtaa

DBGET integrated database retrieval system