KEGG   Homo sapiens (human): 3249Help
Entry
3249              CDS       T01001                                 

Gene name
HPN, TMPRSS1
Definition
hepsin (EC:3.4.21.106)
Orthology
K08665  
hepsin (transmembrane protease, serine 1) [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3249 (HPN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     3249 (HPN)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3249 (HPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.12
AA seq 417 aa AA seqDB search
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaaggagggtggccggactgtgccatgctgctccagacccaaggtggcagct
ctcactgcggggaccctgctacttctgacagccatcggggcggcatcctgggccattgtg
gctgttctcctcaggagtgaccaggagccgctgtacccagtgcaggtcagctctgcggac
gctcggctcatggtctttgacaagacggaagggacgtggcggctgctgtgctcctcgcgc
tccaacgccagggtagccggactcagctgcgaggagatgggcttcctcagggcactgacc
cactccgagctggacgtgcgaacggcgggcgccaatggcacgtcgggcttcttctgtgtg
gacgaggggaggctgccccacacccagaggctgctggaggtcatctccgtgtgtgattgc
cccagaggccgtttcttggccgccatctgccaagactgtggccgcaggaagctgcccgtg
gaccgcatcgtgggaggccgggacaccagcttgggccggtggccgtggcaagtcagcctt
cgctatgatggagcacacctctgtgggggatccctgctctccggggactgggtgctgaca
gccgcccactgcttcccggagcggaaccgggtcctgtcccgatggcgagtgtttgccggt
gccgtggcccaggcctctccccacggtctgcagctgggggtgcaggctgtggtctaccac
gggggctatcttccctttcgggaccccaacagcgaggagaacagcaacgatattgccctg
gtccacctctccagtcccctgcccctcacagaatacatccagcctgtgtgcctcccagct
gccggccaggccctggtggatggcaagatctgtaccgtgacgggctggggcaacacgcag
tactatggccaacaggccggggtactccaggaggctcgagtccccataatcagcaatgat
gtctgcaatggcgctgacttctatggaaaccagatcaagcccaagatgttctgtgctggc
taccccgagggtggcattgatgcctgccagggcgacagcggtggtccctttgtgtgtgag
gacagcatctctcggacgccacgttggcggctgtgtggcattgtgagttggggcactggc
tgtgccctggcccagaagccaggcgtctacaccaaagtcagtgacttccgggagtggatc
ttccaggccataaagactcactccgaagccagcggcatggtgacccagctctga

DBGET integrated database retrieval system