KEGG   Homo sapiens (human): 327Help
Entry
327               CDS       T01001                                 

Gene name
APEH, AARE, ACPH, APH, D3F15S2, D3S48E, DNF15S2, OPH
Definition
(RefSeq) acylaminoacyl-peptide hydrolase (EC:3.4.19.1)
  KO
K01303  
acylaminoacyl-peptidase [EC:3.4.19.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.1  acylaminoacyl-peptidase
     327 (APEH)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   327 (APEH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 732 aa AA seqDB search
MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDLERMEN
IRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQF
LEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTK
ALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGV
PENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSL
AVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIY
CSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLM
VAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYA
GLDFEAILLQPGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGS
TGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQY
PETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAEMLDKSPIRYI
PQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFM
NAVLWLRTHLGS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtcaggtgctgctgagcgagcccgaggaggcggcggctctgtatcggggcctt
agccgccagcccgcgctgagcgccgcctgcctgggcccggaggtcaccacgcagtacggc
ggccaataccggacggtgcacactgagtggacccagagggacctggaacgcatggagaac
attcgattctgccgccaatacctggtgttccatgacggggactcagtggtgtttgcagga
cctgcaggcaacagtgtggagacccggggggaactgctgagcagagagtctccttcaggc
accatgaaagctgtgctgcgcaaggctggaggcacgggccctggggaagagaagcagttc
ctggaggtctgggagaagaaccggaagctcaagagcttcaacctgtcagcgctggagaaa
catgggcctgtttatgaggatgactgctttggctgcctgtcctggtcgcactcggagaca
cacttgttgtatgtggcagagaagaagcgccccaaggccgagtccttctttcagaccaaa
gccttggacgtcagtgccagcgatgatgagatagccaggctgaagaagccagaccaagcc
atcaagggggatcagtttgtgttttatgaagactggggagaaaacatggtttccaaaagc
atccctgtgctctgcgtgctggatgtcgagagtggcaacatctctgtgcttgagggggtc
cctgagaatgtgtcccctggacaggcattttgggcccctggagatgctggtgtggtgttt
gtgggctggtggcatgagcccttccggttgggcatccgcttttgcaccaatcgcaggtca
gccctgtattatgtggacctcatcggggggaagtgtgagctcctctcggatgactccctg
gctgtctcttctccccggctgagcccagaccaatgtcgcattgtctacctgcagtaccca
tctctgatcccccatcaccaatgcagccagctgtgcctgtatgactggtataccaaggtt
acctcagtggtggtagatgttgtgcctcggcagctgggagagaacttctctgggatctac
tgcagccttctgcctttgggatgctggtcagctgacagccagagagtggtctttgactcg
gctcagcgcagccggcaggacctgtttgctgtggacacccaagtgggcactgtgacctcc
ctcacagctggagggtcaggtgggagctggaagttgctcacaattgaccaggacctcatg
gtggcacagttttccacacccagcctacctccaaccctgaaagttgggttcctgccttct
gcagggaaggagcagtcagtgttgtgggtgtccctggaggaggccgagcccattcccgac
atccactggggcatccgggtgctacagccacccccagagcaagagaatgtgcagtatgct
ggccttgactttgaagcaatcctgctgcagcctggcagccctccagataagacccaagtg
cccatggtggtcatgccccacggggggccccattcatcctttgtcactgcctggatgctg
ttcccagccatgctttgcaagatgggctttgcggtactactagtgaactatcgtggctcc
acgggctttggccaggacagcatcctctccctcccaggcaatgtgggccaccaggatgtg
aaggatgtccagtttgcagtggaacaggtgctccaggaggaacactttgatgcaagccat
gtggcccttatgggtggttcccatggtggcttcatttcctgccacttgattggtcagtac
ccagagacctacagggcctgcgtggcccggaaccccgtgatcaacatcgcctccatgttg
ggctccactgacatccctgactggtgcgtggtggaggctggctttcctttcagcagtgac
tgcctgccagacctcagcgtgtgggctgagatgctggacaaatcgcccatcagatacatc
cctcaggtgaagacaccactgttactgatgttgggccaggaggaccggcgtgtgcccttc
aagcagggcatggagtattaccgtgccctcaagacccggaatgtgcctgttcggctcctg
ctctatcccaaaagcacccacgcattatcagaggtggaggtggagtcagacagcttcatg
aatgctgtgctctggctacgcacacacttgggcagctga

DBGET integrated database retrieval system