KEGG   Homo sapiens (human): 3283Help
Entry
3283              CDS       T01001                                 

Gene name
HSD3B1, 3BETAHSD, HSD3B, HSDB3, HSDB3A, I, SDR11E1
Definition
(RefSeq) hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 (EC:1.1.1.145 5.3.3.1)
  KO
K00070  
3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Aldosterone synthesis and secretion
Module
Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Drug target
Epostane: 
Trilostane: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    3283 (HSD3B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3283 (HSD3B1)
   04925 Aldosterone synthesis and secretion
    3283 (HSD3B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     3283 (HSD3B1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     3283 (HSD3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.1
AA seq 373 aa AA seqDB search
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLE
GDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVF
IYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTL
YTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRAL
QDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEI
VSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSL
VDRHKETLKSKTQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgggctggagctgccttgtgacaggagcaggagggtttctgggacagaggatcatc
cgcctcttggtgaaggagaaggagctgaaggagatcagggtcttggacaaggccttcgga
ccagaattgagagaggaattttctaaactccagaacaagaccaagctgacagtgctggaa
ggagacattctggatgagccattcctgaagagagcctgccaggacgtctcggtcatcatc
cacaccgcctgtatcattgatgtcttcggtgtcactcacagagagtctatcatgaatgtc
aatgtgaaaggtacccagctcctgttagaggcctgtgtccaagctagtgtgccagtcttc
atctacaccagtagcatagaggtagccgggcccaactcctacaaggaaatcatccagaat
ggccatgaagaagagcctctggaaaacacatggcccgctccatacccacacagcaaaaag
cttgctgagaaggctgtactggcggctaacgggtggaatctgaaaaacggcggcaccctg
tacacttgtgccttacgacccatgtatatctatggggaaggaagccgattcctttctgct
agtataaacgaggccctgaacaacaatgggatcctgtcaagtgttggaaagttctccact
gttaacccagtctatgttggcaatgtggcctgggcccacattctggccttgagggccctg
caggaccccaagaaggccccaagcatccgaggacagttctactatatctcagatgacacg
cctcaccaaagctatgataaccttaattacaccctgagcaaagagttcggcctccgcctt
gattccagatggagctttcctttatccctgatgtattggattggcttcctgctggaaata
gtgagcttcctactcaggccaatttacacctatcgaccgcccttcaaccgccacatagtc
acattgtcaaatagcgtattcaccttctcttataagaaggctcagcgagatctggcgtat
aagccactctacagctgggaggaagccaagcagaaaacggtggagtgggttggttccctt
gtggaccggcacaaggagaccctgaagtccaagactcagtga

DBGET integrated database retrieval system