KEGG   Homo sapiens (human): 3290Help
Entry
3290              CDS       T01001                                 

Gene name
HSD11B1, 11-DH, 11-beta-HSD1, CORTRD2, HDL, HSD11, HSD11B, HSD11L, SDR26C1
Definition
hydroxysteroid (11-beta) dehydrogenase 1 (EC:1.1.1.146)
Orthology
K15680  
corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Disease
H01111  
Cortisone reductase deficiency (CRD)
Drug target
Carbenoxolone: 
Enoxolone: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32-q41
AA seq 292 aa AA seqDB search
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatgaaaaaatatctcctccccattctggggctcttcatggcctactactac
tattctgcaaacgaggaattcagaccagagatgctccaaggaaagaaagtgattgtcaca
ggggccagcaaagggatcggaagagagatggcttatcatctggcgaagatgggagcccat
gtggtggtgacagcgaggtcaaaagaaactctacagaaggtggtatcccactgcctggag
cttggagcagcctcagcacactacattgctggcaccatggaagacatgaccttcgcagag
caatttgttgcccaagcaggaaagctcatgggaggactagacatgctcattctcaaccac
atcaccaacacttctttgaatctttttcatgatgatattcaccatgtgcgcaaaagcatg
gaagtcaacttcctcagttacgtggtcctgactgtagctgccttgcccatgctgaagcag
agcaatggaagcattgttgtcgtctcctctctggctgggaaagtggcttatccaatggtt
gctgcctattctgcaagcaagtttgctttggatgggttcttctcctccatcagaaaggaa
tattcagtgtccagggtcaatgtatcaatcactctctgtgttcttggcctcatagacaca
gaaacagccatgaaggcagtttctgggatagtccatatgcaagcagctccaaaggaggaa
tgtgccctggagatcatcaaagggggagctctgcgccaagaagaagtgtattatgacagc
tcactctggaccactcttctgatcagaaatccatgcaggaagatcctggaatttctctac
tcaacgagctataatatggacagattcataaacaagtag

DBGET integrated database retrieval system