KEGG   Homo sapiens (human): 3290Help
Entry
3290              CDS       T01001                                 

Gene name
HSD11B1, 11-DH, 11-beta-HSD1, CORTRD2, HDL, HSD11, HSD11B, HSD11L, SDR26C1
Definition
hydroxysteroid (11-beta) dehydrogenase 1 (EC:1.1.1.146)
Orthology
K15680  
corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Disease
H01111  
Cortisone reductase deficiency (CRD)
Drug target
Carbenoxolone: 
Enoxolone: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    3290 (HSD11B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    3290 (HSD11B1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    3290 (HSD11B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.146  11beta-hydroxysteroid dehydrogenase
     3290 (HSD11B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32-q41
AA seq 292 aa AA seqDB search
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatgaaaaaatatctcctccccattctggggctcttcatggcctactactac
tattctgcaaacgaggaattcagaccagagatgctccaaggaaagaaagtgattgtcaca
ggggccagcaaagggatcggaagagagatggcttatcatctggcgaagatgggagcccat
gtggtggtgacagcgaggtcaaaagaaactctacagaaggtggtatcccactgcctggag
cttggagcagcctcagcacactacattgctggcaccatggaagacatgaccttcgcagag
caatttgttgcccaagcaggaaagctcatgggaggactagacatgctcattctcaaccac
atcaccaacacttctttgaatctttttcatgatgatattcaccatgtgcgcaaaagcatg
gaagtcaacttcctcagttacgtggtcctgactgtagctgccttgcccatgctgaagcag
agcaatggaagcattgttgtcgtctcctctctggctgggaaagtggcttatccaatggtt
gctgcctattctgcaagcaagtttgctttggatgggttcttctcctccatcagaaaggaa
tattcagtgtccagggtcaatgtatcaatcactctctgtgttcttggcctcatagacaca
gaaacagccatgaaggcagtttctgggatagtccatatgcaagcagctccaaaggaggaa
tgtgccctggagatcatcaaagggggagctctgcgccaagaagaagtgtattatgacagc
tcactctggaccactcttctgatcagaaatccatgcaggaagatcctggaatttctctac
tcaacgagctataatatggacagattcataaacaagtag

DBGET integrated database retrieval system