KEGG   Homo sapiens (human): 3291Help
Entry
3291              CDS       T01001                                 

Gene name
HSD11B2, AME, AME1, HSD11K, HSD2, SDR9C3
Definition
hydroxysteroid (11-beta) dehydrogenase 2 (EC:1.1.1.146)
Orthology
K00071  
corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Aldosterone-regulated sodium reabsorption
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Disease
H00259  
Apparent mineralocorticoid excess syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    3291 (HSD11B2)
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3291 (HSD11B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     3291 (HSD11B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22
AA seq 405 aa AA seqDB search
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctggccttggccgtcgggcggcgcctggctgctcgtggctgcccgcgcgctg
ctgcagctgctgcgctcagacctgcgtctgggccgcccgctgctggcggcgctggcgctg
ctggccgcgctcgactggctgtgccagcgcctgctgcccccgccggccgcactcgccgtg
ctggccgccgccggctggatcgcgttgtcccgcctggcgcgcccgcagcgcctgccggtg
gccactcgcgcggtgctcatcaccggctgtgactctggttttggcaaggagacggccaag
aaactggactccatgggcttcacggtgctggccaccgtattggagttgaacagccccggt
gccatcgagctgcgtacctgctgctcccctcgcctaaggctgctgcagatggacctgacc
aaaccaggagacattagccgcgtgctagagttcaccaaggcccacaccaccagcaccggc
ctgtggggcctcgtcaacaacgcaggccacaatgaagtagttgctgatgcggagctgtct
ccagtggccactttccgtagctgcatggaggtgaatttctttggcgcgctcgagctgacc
aagggcctcctgcccctgctgcgcagctcaaggggccgcatcgtgactgtggggagccca
gcgggggacatgccatatccgtgcttgggggcctatggaacctccaaagcggccgtggcg
ctactcatggacacattcagctgtgaactccttccctggggggtcaaggtcagcatcatc
cagcctggctgcttcaagacagagtcagtgagaaacgtgggtcagtgggaaaagcgcaag
caattgctgctggccaacctgcctcaagagctgctgcaggcctacggcaaggactacatc
gagcacttgcatgggcagttcctgcactcgctacgcctggccatgtccgacctcacccca
gttgtagatgccatcacagatgcgctgctggcagctcggccccgccgccgctattacccc
ggccagggcctggggctcatgtacttcatccactactacctgcctgaaggcctgcggcgc
cgcttcctgcaggccttcttcatcagtcactgtctgcctcgagcactgcagcctggccag
cctggcactaccccaccacaggacgcagcccaggacccaaacctgagccccggcccttcc
ccagcagtggctcggtga

DBGET integrated database retrieval system