KEGG   Homo sapiens (human): 3293Help
Entry
3293              CDS       T01001                                 

Gene name
HSD17B3, EDH17B3, SDR12C2
Definition
hydroxysteroid (17-beta) dehydrogenase 3 (EC:1.1.1.64)
Orthology
K10207  
testosterone 17beta-dehydrogenase (NADP+) [EC:1.1.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Disease
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22
AA seq 310 aa AA seqDB search
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtcctggaacagttcttcatcctcacagggctgctggtgtgcctggcctgc
ctggcgaagtgcgtgagattctccagatgtgttttactgaactactggaaagttttgcca
aagtctttcttgcggtcaatgggacagtgggcagtgatcactggagcaggcgatggaatt
gggaaagcgtactcgttcgagctagcaaaacgtggactcaatgttgtccttattagccgg
acgctggaaaaactagaggccattgccacagagatcgagcggactacagggaggagtgtg
aagattatacaagcagattttacaaaagatgacatctacgagcatattaaagaaaaactt
gcaggcttagaaattggaattttagtcaacaatgtcggaatgcttccaaaccttctccca
agccatttcctgaacgcaccggatgaaatccagagcctcatccattgtaacatcacctcc
gtagtcaagatgacacagctaattctgaaacatatggaatcaaggcagaaaggtctcatc
ctgaacatttcttctgggatagccctgtttccttggcctctctactccatgtactcagct
tccaaggcgtttgtgtgcgcattttccaaggccctgcaagaggaatataaagcaaaagaa
gtcatcatccaggtgctgaccccatatgctgtctcgactgcaatgacaaagtatctaaat
acaaatgtgataaccaagactgctgatgagtttgtcaaagagtcattgaattatgtcaca
attggaggtgaaacctgtggctgccttgcccatgaaatcttggcgggctttctgagcctg
atcccggcctgggccttctacagcggtgccttccaaaggctgctcctgacacactatgtg
gcatacctgaagctcaacaccaaggtcaggtag

DBGET integrated database retrieval system