KEGG   Homo sapiens (human): 3293Help
Entry
3293              CDS       T01001                                 

Gene name
HSD17B3, EDH17B3, SDR12C2
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 3
  KO
K10207  testosterone 17beta-dehydrogenase (NADP+) [EC:1.1.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
Disease
H00608  46,XY disorders of sex development (Disorders in androgen synthesis or action)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    3293 (HSD17B3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.64  testosterone 17beta-dehydrogenase (NADP+)
     3293 (HSD17B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP ApbA Shikimate_DH DUF3993
Motif
Other DBs
NCBI-GeneID: 3293
NCBI-ProteinID: NP_000188
OMIM: 605573
HGNC: 5212
Ensembl: ENSG00000130948
Vega: OTTHUMG00000020292
Pharos: P37058(Tchem)
UniProt: P37058 Q6FH62
Position
9q22.32
AA seq 310 aa AA seqDB search
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtcctggaacagttcttcatcctcacagggctgctggtgtgcctggcctgc
ctggcgaagtgcgtgagattctccagatgtgttttactgaactactggaaagttttgcca
aagtctttcttgcggtcaatgggacagtgggcagtgatcactggagcaggcgatggaatt
gggaaagcgtactcgttcgagctagcaaaacgtggactcaatgttgtccttattagccgg
acgctggaaaaactagaggccattgccacagagatcgagcggactacagggaggagtgtg
aagattatacaagcagattttacaaaagatgacatctacgagcatattaaagaaaaactt
gcaggcttagaaattggaattttagtcaacaatgtcggaatgcttccaaaccttctccca
agccatttcctgaacgcaccggatgaaatccagagcctcatccattgtaacatcacctcc
gtagtcaagatgacacagctaattctgaaacatatggaatcaaggcagaaaggtctcatc
ctgaacatttcttctgggatagccctgtttccttggcctctctactccatgtactcagct
tccaaggcgtttgtgtgcgcattttccaaggccctgcaagaggaatataaagcaaaagaa
gtcatcatccaggtgctgaccccatatgctgtctcgactgcaatgacaaagtatctaaat
acaaatgtgataaccaagactgctgatgagtttgtcaaagagtcattgaattatgtcaca
attggaggtgaaacctgtggctgccttgcccatgaaatcttggcgggctttctgagcctg
atcccggcctgggccttctacagcggtgccttccaaaggctgctcctgacacactatgtg
gcatacctgaagctcaacaccaaggtcaggtag

DBGET integrated database retrieval system