KEGG   Homo sapiens (human): 3294Help
Entry
3294              CDS       T01001                                 

Gene name
HSD17B2, EDH17B2, HSD17, SDR9C2
Definition
hydroxysteroid (17-beta) dehydrogenase 2 (EC:1.1.1.62 1.1.1.239)
Orthology
K13368  
17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.1-q24.2
AA seq 387 aa AA seqDB search
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttcttctcggacacagcatggatctgcctggctgtccccacagtactatgt
gggacagtattttgcaaatacaagaagagctcagggcagctgtggagctggatggtctgc
ctggcaggcctctgtgcagtctgcctgctcatcctgtcccctttttggggcttgatcctc
ttctcggtgtcatgcttcctcatgtatacttacttatctggccaagaattgttacctgtg
gatcagaaggcagtcctggtgacaggtggtgattgcgggcttggccatgctttgtgcaag
tatctggatgagctgggcttcacggtatttgccggagttttgaatgaaaatggcccagga
gctgaggaattgcgaagaacctgctctccgcgcctctcggtgctccaaatggacatcacg
aagccagtgcagataaaagatgcttacagcaaggttgcagcaatgctgcaggacagagga
ctgtgggctgtgatcaacaatgctggggtgcttggctttccaactgatggggagcttctt
cttatgactgactacaaacaatgcatggccgtgaacttctttggaactgtggaggtcaca
aagacgtttttgcctcttcttagaaaatccaaagggaggctggtgaatgtcagcagcatg
ggaggaggggccccaatggaaaggctggcatcttatggctcatcaaaggcggctgtgacc
atgttctcatcagttatgagactggagctttccaagtggggaattaaagttgcttccatc
caacctggaggcttcctaacaaatatcgcaggcaccagtgacaagtgggaaaagctggag
aaggacattctggaccacctccccgctgaggtacaggaagactacggccaggactacatc
ttagcacagcggaatttcctcctattgatcaactcgttagccagcaaggacttctctccg
gtgctgcgggacatccagcatgctatcttggcgaagagcccttttgcctattacacgcca
gggaaaggcgcttacttgtggatctgccttgctcactatttgcctattggcatatatgat
tactttgctaaaagacattttggccaagacaagcccatgcccagagctctaagaatgcct
aactacaagaaaaaggccacctag

DBGET integrated database retrieval system