KEGG   Homo sapiens (human): 3297Help
Entry
3297              CDS       T01001                                 

Gene name
HSF1, HSTF1
Definition
(RefSeq) heat shock transcription factor 1
  KO
K09414  heat shock transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3297 (HSF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Heat shock factors
    3297 (HSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vert_HS_TF HSF_DNA-bind ZapB DUF2813
Motif
Other DBs
NCBI-GeneID: 3297
NCBI-ProteinID: NP_005517
OMIM: 140580
HGNC: 5224
Ensembl: ENSG00000185122
Vega: OTTHUMG00000174604
Pharos: Q00613(Tbio)
UniProt: Q00613
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 529 aa AA seqDB search
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccgtgggccccggcgcggcggggcccagcaacgtcccggccttcctgacc
aagctgtggaccctcgtgagcgacccggacaccgacgcgctcatctgctggagcccgagc
gggaacagcttccacgtgttcgaccagggccagtttgccaaggaggtgctgcccaagtac
ttcaagcacaacaacatggccagcttcgtgcggcagctcaacatgtatggcttccggaaa
gtggtccacatcgagcagggcggcctggtcaagccagagagagacgacacggagttccag
cacccatgcttcctgcgtggccaggagcagctccttgagaacatcaagaggaaagtgacc
agtgtgtccaccctgaagagtgaagacataaagatccgccaggacagcgtcaccaagctg
ctgacggacgtgcagctgatgaaggggaagcaggagtgcatggactccaagctcctggcc
atgaagcatgagaatgaggctctgtggcgggaggtggccagccttcggcagaagcatgcc
cagcaacagaaagtcgtcaacaagctcattcagttcctgatctcactggtgcagtcaaac
cggatcctgggggtgaagagaaagatccccctgatgctgaacgacagtggctcagcacat
tccatgcccaagtatagccggcagttctccctggagcacgtccacggctcgggcccctac
tcggccccctccccagcctacagcagctccagcctctacgcccctgatgctgtggccagc
tctggacccatcatctccgacatcaccgagctggctcctgccagccccatggcctccccc
ggcgggagcatagacgagaggcccctatccagcagccccctggtgcgtgtcaaggaggag
ccccccagcccgcctcagagcccccgggtagaggaggcgagtcccgggcgcccatcttcc
gtggacaccctcttgtccccgaccgccctcattgactccatcctgcgggagagtgaacct
gcccccgcctccgtcacagccctcacggacgccaggggccacacggacaccgagggccgg
cctccctcccccccgcccacctccacccctgaaaagtgcctcagcgtagcctgcctggac
aagaatgagctcagtgaccacttggatgctatggactccaacctggataacctgcagacc
atgctgagcagccacggcttcagcgtggacaccagtgccctgctggacctgttcagcccc
tcggtgaccgtgcccgacatgagcctgcctgaccttgacagcagcctggccagtatccaa
gagctcctgtctccccaggagccccccaggcctcccgaggcagagaacagcagcccggat
tcagggaagcagctggtgcactacacagcgcagccgctgttcctgctggaccccggctcc
gtggacaccgggagcaacgacctgccggtgctgtttgagctgggagagggctcctacttc
tccgaaggggacggcttcgccgaggaccccaccatctccctgctgacaggctcggagcct
cccaaagccaaggaccccactgtctcctag

DBGET integrated database retrieval system