KEGG   Homo sapiens (human): 3300Help
Entry
3300              CDS       T01001                                 

Gene name
DNAJB2, CMT2T, DSMA5, HSJ-1, HSJ1, HSPF3
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B2
  KO
K09508  
DnaJ homolog subfamily B member 2
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H00455  
Spinal muscular atrophy (SMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3300 (DNAJB2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3300 (DNAJB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P25686(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 324 aa AA seqDB search
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctactacgagatcctagacgtgccgcgaagtgcgtccgctgatgacatcaag
aaggcgtatcggcgcaaggctctccagtggcacccagacaaaaacccagataataaagag
tttgctgagaagaaatttaaggaggtggccgaggcatatgaagtgctgtctgacaagcac
aagcgggagatttacgaccgctatggccgggaagggctgacagggacaggaactggccca
tctcgggcagaagctggcagtggtgggcctggcttcaccttcaccttccgcagccccgag
gaggtcttccgggaattctttgggagtggagacccttttgcagagctctttgatgacctg
ggccccttctcagagcttcagaaccggggttcccgacactcaggccccttctttaccttc
tcttcctccttccctgggcactccgatttctcctcctcatctttctccttcagtcctggg
gctggtgcttttcgctctgtttctacatctaccacctttgtccaaggacgccgcatcacc
acacgcagaatcatggagaacgggcaggagcgggtggaagtggaggaggatgggcagctg
aagtcagtcacaatcaatggtgtcccagatgacctggcactgggcttggagctgagccgt
cgcgagcagcagccgtcagtcacttccaggtctgggggcactcaggtccagcagacccct
gcctcatgccccttggacagcgacctctctgaggatgaggacctgcagctggccatggcc
tacagcctgtcagagatggaggcagctgggaagaaacccgcaggtgggcgggaggcacag
caccgacggcaggggcggcccaaggcccagcaccaagatccaggcttgggggggacccag
gagggtgcgaggggtgaagcaaccaaacgcagtccatccccagaggagaaggcctctcgc
tgcctcatcctctga

DBGET integrated database retrieval system