KEGG   Homo sapiens (human): 3301Help
Entry
3301              CDS       T01001                                 

Gene name
DNAJA1, DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSPF4, NEDD7, hDJ-2
Definition
DnaJ (Hsp40) homolog, subfamily A, member 1
Orthology
K09502  
DnaJ homolog subfamily A member 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3301 (DNAJA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 397 aa AA seqDB search
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaacaacttactacgatgttttgggggtcaaacccaatgctactcaggaa
gaattgaaaaaggcttataggaaactggctttgaagtaccatcctgataagaacccaaat
gaaggagagaagtttaaacagatttctcaagcttacgaagttctctctgatgcaaagaaa
agggaattatatgacaaaggaggagaacaggcaattaaagagggtggagcaggtggcggt
tttggctcccccatggacatctttgatatgttttttggaggaggaggaaggatgcagaga
gaaaggagaggtaaaaatgttgtacatcagctctcagtaaccctagaagacttatataat
ggtgcaacaagaaaactggctctgcaaaagaatgtgatttgtgacaaatgtgaaggtaga
ggaggtaagaaaggagcagtagagtgctgtcccaattgccgaggtactggaatgcaaata
agaattcatcagataggacctggaatggttcagcaaattcagtctgtgtgcatggagtgc
cagggccatggggagcggatcagtcctaaagatagatgtaaaagctgcaacggaaggaag
atagttcgagagaagaaaattttagaagttcatattgacaaaggcatgaaagatggccag
aagataacattccatggtgaaggagaccaagaaccaggactggagccaggcgatattatc
attgtgttagatcagaaggaccatgctgtttttactcgacgaggagaagaccttttcatg
tgtatggacatacagctcgttgaagcactgtgtggcttccagaagccaatatctactctt
gacaaccgaaccatcgtcatcacctctcatccaggtcagattgtcaagcatggagatatc
aagtgtgtactaaatgaaggcatgccaatttatcgtagaccatatgaaaagggtcgccta
atcatcgaatttaaggtaaactttcctgagaatggctttctctctcctgataaactgtct
ttgctggaaaaactcctacccgagaggaaggaagtggaagagactgatgagatggaccaa
gtagaactggtggactttgatccaaatcaggaaagacggcgccactacaatggagaagca
tatgaggatgatgaacatcatcccagaggtggtgttcagtgtcagacctcttaa

DBGET integrated database retrieval system