KEGG   Homo sapiens (human): 3303Help
Entry
3303              CDS       T01001                                 

Gene name
HSPA1A, HEL-S-103, HSP70-1, HSP70-1A, HSP70.1, HSP70I, HSP72, HSPA1
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Prion diseases
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3303 (HSPA1A)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3303 (HSPA1A)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3303 (HSPA1A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3303 (HSPA1A)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3303 (HSPA1A)
  Endocrine system
   04915 Estrogen signaling pathway
    3303 (HSPA1A)
  Aging
   04213 Longevity regulating pathway - multiple species
    3303 (HSPA1A)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    3303 (HSPA1A)
  Infectious diseases
   05134 Legionellosis
    3303 (HSPA1A)
   05162 Measles
    3303 (HSPA1A)
   05164 Influenza A
    3303 (HSPA1A)
   05169 Epstein-Barr virus infection
    3303 (HSPA1A)
   05145 Toxoplasmosis
    3303 (HSPA1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3303 (HSPA1A)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3303 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    3303 (HSPA1A)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3303 (HSPA1A)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3303 (HSPA1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3303 (HSPA1A)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3303 (HSPA1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3303 (HSPA1A)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3303 (HSPA1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3303 (HSPA1A)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3303 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 641 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccaacacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgattggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctccgacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagattcacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaagacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccttggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgccggtggtcccgggcctggg
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggta
gattag

KEGG   Homo sapiens (human): 3304Help
Entry
3304              CDS       T01001                                 

Gene name
HSPA1B, HSP70-1B, HSP70-2, HSP70.2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1B
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3304 (HSPA1B)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3304 (HSPA1B)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3304 (HSPA1B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3304 (HSPA1B)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3304 (HSPA1B)
  Endocrine system
   04915 Estrogen signaling pathway
    3304 (HSPA1B)
  Aging
   04213 Longevity regulating pathway - multiple species
    3304 (HSPA1B)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3304 (HSPA1B)
   05162 Measles
    3304 (HSPA1B)
   05164 Influenza A
    3304 (HSPA1B)
   05169 Epstein-Barr virus infection
    3304 (HSPA1B)
   05145 Toxoplasmosis
    3304 (HSPA1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3304 (HSPA1B)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3304 (HSPA1B)
 Complex C
   Prp19-CDC5 complex
    3304 (HSPA1B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3304 (HSPA1B)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3304 (HSPA1B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3304 (HSPA1B)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3304 (HSPA1B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3304 (HSPA1B)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3304 (HSPA1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3304 (HSPA1B)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3304 (HSPA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P0DMV8(Tchem) P0DMV9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 641 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccaacacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctccgacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagattcacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaagacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggttctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccttggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgccggtggtcccgggcctggc
ggcttcggggctcagggtcccaagggagggtctgggtcaggccctaccattgaggaggtg
gattag

KEGG   Homo sapiens (human): 3305Help
Entry
3305              CDS       T01001                                 

Gene name
HSPA1L, HSP70-1L, HSP70-HOM, HSP70T, hum70t
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1 like
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3305 (HSPA1L)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3305 (HSPA1L)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3305 (HSPA1L)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3305 (HSPA1L)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3305 (HSPA1L)
  Endocrine system
   04915 Estrogen signaling pathway
    3305 (HSPA1L)
  Aging
   04213 Longevity regulating pathway - multiple species
    3305 (HSPA1L)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3305 (HSPA1L)
   05162 Measles
    3305 (HSPA1L)
   05164 Influenza A
    3305 (HSPA1L)
   05169 Epstein-Barr virus infection
    3305 (HSPA1L)
   05145 Toxoplasmosis
    3305 (HSPA1L)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3305 (HSPA1L)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3305 (HSPA1L)
 Complex C
   Prp19-CDC5 complex
    3305 (HSPA1L)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3305 (HSPA1L)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3305 (HSPA1L)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3305 (HSPA1L)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3305 (HSPA1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3305 (HSPA1L)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3305 (HSPA1L)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3305 (HSPA1L)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3305 (HSPA1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P34931(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 641 aa AA seqDB search
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctactgccaagggaatcgccataggcatcgacctgggcaccacctactcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacc
cccagctacgtggccttcacagacaccgagcggctcattggggatgcggccaagaaccag
gtagcaatgaatccccagaacactgtttttgatgctaaacgtctgatcggcaggaaattt
aatgatcctgttgtacaagcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtccttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtattgactaagttgaaggagactgctgaggcctttttgggccaccct
gtcaccaatgcagtgattaccgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctaagaatcatcaatgagcccacggct
gctgccattgcctatggtttagataaaggaggtcaaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaggagttcaagaggaaacacaaaaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctatacatccatcacc
agagctcgatttgaagagttgtgtgcagacctgtttaggggtaccctggagcctgtagaa
aaagcgcttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactacttcaatggacgtgat
ctcaacaagagcatcaaccctgatgaggccgtagcatatggggctgcggtacaagcagcc
atcctgatgggggacaagtctgagaaggtacaggacctgctgctgctggacgtggctccc
ctgtccctggggctggagacggctgggggcgtgatgactgccctgataaagcgcaactcc
accatccccaccaagcagacacagattttcaccacctactctgacaaccaacccggggtg
ctgatccaggtgtatgagggcgagagggccatgacaaaggacaacaacctgctggggcgg
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccacggacaagagcaccggcaaggtg
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagattagtgagtctgataaaaataaaatattggataaatgcaacgagctcctt
tcgtggctggaggtcaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccctatcatcacaaaactctaccaaggaggatgcactgggcct
gcctgcggaacagggtatgtgcctggaaggcctgccacaggccccacaattgaagaagta
gattaa

KEGG   Homo sapiens (human): 3306Help
Entry
3306              CDS       T01001                                 

Gene name
HSPA2, HSP70-2, HSP70-3
Definition
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3306 (HSPA2)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3306 (HSPA2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3306 (HSPA2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3306 (HSPA2)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3306 (HSPA2)
  Endocrine system
   04915 Estrogen signaling pathway
    3306 (HSPA2)
  Aging
   04213 Longevity regulating pathway - multiple species
    3306 (HSPA2)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3306 (HSPA2)
   05162 Measles
    3306 (HSPA2)
   05164 Influenza A
    3306 (HSPA2)
   05169 Epstein-Barr virus infection
    3306 (HSPA2)
   05145 Toxoplasmosis
    3306 (HSPA2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3306 (HSPA2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3306 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    3306 (HSPA2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3306 (HSPA2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3306 (HSPA2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3306 (HSPA2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3306 (HSPA2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3306 (HSPA2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3306 (HSPA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3306 (HSPA2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3306 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P54652(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 639 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgtggcccggctatcggcatcgacctgggcaccacctattcgtgcgtcggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaatcgcaccaccccc
agctacgtggccttcacggacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgattggacggaaattcgag
gatgccacagtgcagtcggatatgaaacactggccgttccgggtggtgagcgagggaggc
aagcccaaagtgcaagtagagtacaagggggagaccaagaccttcttcccagaggagata
tcctccatggtcctcacgaagatgaaggagatcgcggaagcctacctggggggcaaggtg
cacagcgcggtcataacggtcccggcctatttcaacgactcgcagcgccaggccaccaag
gacgcaggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacggcggcg
gccatcgcctacggcctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggtggcactttcgacgtgtccatcctgaccatcgaggatggcatcttc
gaggtgaagtccacggccggcgacacccacctgggcggtgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgccgtgaggcggctgcgcaccgcttgcgagcgcgccaagcgcaccctgagctcgtcc
acgcaggcgagcatcgagatcgactcgctctacgagggcgtggacttctatacgtccatc
acgcgcgcccgcttcgaggagctcaatgccgacctctttcgcgggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctatggcgccgcggtgcaggcg
gccatcctcatcggcgacaaatcagagaatgtgcaggacctgctgctactcgacgtgacc
ccgttgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtactggtgcaggtatacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgcgcctcgcggggtcccccaaatcgaggttacc
ttcgacattgacgccaatggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccatcaccaatgacaaaggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcggtacaaatcggaagatgaggcgaatcgcgaccgagtcgcg
gccaaaaacgccctggagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtttgcaaccccatcatcagcaaactttaccaaggtggtcctggcggc
ggcagcggcggcggcggttcaggagcctccgggggacccaccatcgaagaagtggactaa

KEGG   Homo sapiens (human): 3310Help
Entry
3310              CDS       T01001                                 

Gene name
HSPA6, HSP70B'
Definition
(RefSeq) heat shock protein family A (Hsp70) member 6
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3310 (HSPA6)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3310 (HSPA6)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3310 (HSPA6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3310 (HSPA6)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3310 (HSPA6)
  Endocrine system
   04915 Estrogen signaling pathway
    3310 (HSPA6)
  Aging
   04213 Longevity regulating pathway - multiple species
    3310 (HSPA6)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3310 (HSPA6)
   05162 Measles
    3310 (HSPA6)
   05164 Influenza A
    3310 (HSPA6)
   05169 Epstein-Barr virus infection
    3310 (HSPA6)
   05145 Toxoplasmosis
    3310 (HSPA6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3310 (HSPA6)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3310 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    3310 (HSPA6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3310 (HSPA6)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3310 (HSPA6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3310 (HSPA6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3310 (HSPA6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3310 (HSPA6)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3310 (HSPA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3310 (HSPA6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3310 (HSPA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P17066(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 643 aa AA seqDB search
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagggccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtcggggacgcggccaagagccag
gcggccctgaacccccacaacaccgtgttcgatgccaagcggctgatcgggcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccgggtggtgagcgagggc
ggcaagcccaaggtgcgcgtatgctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggccgaggcgtacctgggccagccc
gtgaagcacgcagtgatcaccgtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgttgcggatcatcaatgagcccacggca
gctgccatcgcctatgggctggaccggcggggcgcgggagagcgcaacgtgctcattttt
gacctgggtgggggcaccttcgatgtgtcggttctctccattgacgctggtgtctttgag
gtgaaagccactgctggagatacccacctgggaggagaggacttcgacaaccggctcgtg
aaccacttcatggaagaattccggcggaagcatgggaaggacctgagcgggaacaagcgt
gccctgcgcaggctgcgcacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagatagactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgcagcaccctggagccggtggag
aaggccctgcgggatgccaagctggacaaggcccagattcatgacgtcgtcctggtgggg
ggctccacacgcatccccaaggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccctgatgaggctgtggcctatggggctgctgtgcaggcggcc
gtgttgatgggggacaaatgtgagaaagtgcaggatctcctgctgctggatgtggctccc
ctgtctctggggctggagacagcaggtggggtgatgaccacgctgatccagaggaacgcc
actatccccaccaagcagacccagactttcaccacctactcggacaaccagcctggggtc
ttcatccaggtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgt
tttgaactcagtggcatccctcctgccccacgtggagtcccccagatagaggtgactttt
gacattgatgctaatggcatcctgagcgtgacagccactgacaggagcacaggtaaggct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcatgaagccgagcagtacaaggctgaggatgaggcccagagggacagagtggctgcc
aaaaactcgctggaggcccatgtcttccatgtgaaaggttctttgcaagaggaaagcctt
agggacaagattcccgaagaggacaggcgcaaaatgcaagacaagtgtcgggaagtcctt
gcctggctggagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggag
ctggagcaaatctgtcgccccatcttctccaggctctatggggggcctggtgtccctggg
ggcagcagttgtggcactcaagcccgccagggggaccccagcaccggccccatcattgag
gaggttgattga

KEGG   Homo sapiens (human): 3312Help
Entry
3312              CDS       T01001                                 

Gene name
HSPA8, HEL-33, HEL-S-72p, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, LAP-1, LAP1, NIP71
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3312 (HSPA8)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3312 (HSPA8)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3312 (HSPA8)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3312 (HSPA8)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3312 (HSPA8)
  Endocrine system
   04915 Estrogen signaling pathway
    3312 (HSPA8)
  Aging
   04213 Longevity regulating pathway - multiple species
    3312 (HSPA8)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    3312 (HSPA8)
   05162 Measles
    3312 (HSPA8)
   05164 Influenza A
    3312 (HSPA8)
   05169 Epstein-Barr virus infection
    3312 (HSPA8)
   05145 Toxoplasmosis
    3312 (HSPA8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3312 (HSPA8)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3312 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    3312 (HSPA8)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3312 (HSPA8)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3312 (HSPA8)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3312 (HSPA8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3312 (HSPA8)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3312 (HSPA8)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3312 (HSPA8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3312 (HSPA8)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     3312 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P11142(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.1
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggacctgcagttggtattgatcttggcaccacctactcttgtgtgggtgtt
ttccagcacggaaaagtcgagataattgccaatgatcagggaaaccgaaccactccaagc
tatgtcgcctttacggacactgaacggttgatcggtgatgccgcaaagaatcaagttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgattggacgcagatttgatgat
gctgttgtccagtctgatatgaaacattggccctttatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagcttctatccagaggaggtgtct
tctatggttctgacaaagatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctgtggtcacagtgccagcttactttaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaattattaatgagccaactgctgctgct
attgcttacggcttagacaaaaaggttggagcagaaagaaacgtgctcatctttgacctg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatctttgaggtcaag
tctacagctggagacacccacttgggtggagaagattttgacaaccgaatggtcaaccat
tttattgctgagtttaagcgcaagcataagaaggacatcagtgagaacaagagagctgta
agacgcctccgtactgcttgtgaacgtgctaagcgtaccctctcttccagcacccaggcc
agtattgagatcgattctctctatgaaggaatcgacttctatacctccattacccgtgcc
cgatttgaagaactgaatgctgacctgttccgtggcaccctggacccagtagagaaagcc
cttcgagatgccaaactagacaagtcacagattcatgatattgtcctggttggtggttct
actcgtatccccaagattcagaagcttctccaagacttcttcaatggaaaagaactgaat
aagagcatcaaccctgatgaagctgttgcttatggtgcagctgtccaggcagccatcttg
tctggagacaagtctgagaatgttcaagatttgctgctcttggatgtcactcctctttcc
cttggtattgaaactgctggtggagtcatgactgtcctcatcaagcgtaataccaccatt
cctaccaagcagacacagaccttcactacctattctgacaaccagcctggtgtgcttatt
caggtttatgaaggcgagcgtgccatgacaaaggataacaacctgcttggcaagtttgaa
ctcacaggcatacctcctgcaccccgaggtgttcctcagattgaagtcacttttgacatt
gatgccaatggtatactcaatgtctctgctgtggacaagagtacgggaaaagagaacaag
attactatcactaatgacaagggccgtttgagcaaggaagacattgaacgtatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagggacaaggtgtcatccaagaat
tcacttgagtcctatgccttcaacatgaaagcaactgttgaagatgagaaacttcaaggc
aagattaacgatgaggacaaacagaagattctggacaagtgtaatgaaattatcaactgg
cttgataagaatcagactgctgagaaggaagaatttgaacatcaacagaaagagctggag
aaagtttgcaaccccatcatcaccaagctgtaccagagtgcaggaggcatgccaggagga
atgcctgggggatttcctggtggtggagctcctccctctggtggtgcttcctcagggccc
accattgaagaggttgattaa

DBGET integrated database retrieval system