KEGG   Homo sapiens (human): 3326Help
Entry
3326              CDS       T01001                                 

Gene name
HSP90AB1, D6S182, HSP84, HSP90B, HSPC2, HSPCB
Definition
heat shock protein 90kDa alpha (cytosolic), class B member 1
Orthology
K04079  
molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Antigen processing and presentation
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3326 (HSP90AB1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3326 (HSP90AB1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    3326 (HSP90AB1)
   04612 Antigen processing and presentation
    3326 (HSP90AB1)
  Endocrine system
   04915 Estrogen signaling pathway
    3326 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    3326 (HSP90AB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3326 (HSP90AB1)
   05215 Prostate cancer
    3326 (HSP90AB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3326 (HSP90AB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3326 (HSP90AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3326 (HSP90AB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgttggcttttattctgcctacttggtggca
gagaaagtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgtgctgaccatggtgagcccattggcaggggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacctagaagagaggcgggtcaaagaa
gtagtgaagaagcattctcagttcataggctatcccatcaccctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaaacccaagatcgaagatgtgggttcagatgaggaggatgac
agcggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gaactaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcactaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctatttattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgccgtgtg
ttcatcatggacagctgtgatgagttgataccagagtatctcaattttatccgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgcaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaagactccactaaccgccgccgcctgtctgagctgctgcgctatcatacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggaatttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaagaagatggaagagagcaaggcaaagttt
gagaacctctgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatc
tccaatagacttgtgtcttcaccttgctgcattgtgaccagcacctacggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctatcttctggcttttcccttgaggatccccagacccactccaaccgcatc
tatcgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
aatgctgcagttcctgatgagatcccccctctcgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

DBGET integrated database retrieval system