KEGG   Homo sapiens (human): 3350Help
Entry
3350              CDS       T01001                                 

Gene name
HTR1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
Definition
5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Orthology
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Methylergometrine: 
Ergot alkaloids: 
Ergometrine: 
Lisuride: 
Metergoline: 
Dihydroergotamine: 
Ergotamine: 
Methysergide: 
Naratriptan: 
Pizotifen: 
Lurasidone: 
Clozapine: 
Asenapine: 
Aripiprazole: 
Buspirone: 
Mianserin: 
Gepirone: 
Vilazodone: 
Vortioxetine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5q11.2-q13
AA seq 422 aa AA seqDB search
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccggctccctttgag
accggcggcaacactactggtatctccgacgtgaccgtcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttggagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttggtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtaacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcttgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggatcatggctacactatctattccacc
tttggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagacggtcaaaaaggtggagaagaccggagcggacacc
cgccatggagcatctcccgccccgcagcccaagaagagtgtgaatggagagtcggggagc
aggaactggaggctgggcgtggagagcaaggctgggggtgctctgtgcgccaatggcgcg
gtgaggcaaggtgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggtcctaccccttgtgcccccgcctct
ttcgagaggaaaaatgagcgcaacgccgaggcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgcccaccctg
ttgggcgccataatcaattggctgggctactccaactctctgcttaaccccgtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

DBGET integrated database retrieval system