KEGG   Homo sapiens (human): 3350Help
Entry
3350              CDS       T01001                                 

Gene name
HTR1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction
Drug target
Adatanserin hydrochloride: 
Aripiprazole (DG00906): 
Asenapine: 
Bifeprunox (DG01304): 
Binospirone mesylate: 
Brexpiprazole: 
Buspirone (DG00913): 
Cinitapride (DG01520): 
Clozapine: 
Dihydroergotamine (DG00833): 
Eptapirone: 
Ergometrine (DG00446): 
Ergot alkaloids: 
Ergotamine (DG00834): 
Flesinoxan: 
Flibanserin: 
Gepirone: 
Indorenate hydrochloride: 
Ipsapirone hydrochloride: 
Lecozotan hydrochloride: 
Lisuride (DG00453): 
Lurasidone: 
Metergoline: 
Methylergometrine (DG00445): 
Methysergide (DG00835): 
Mianserin (DG00951): 
Naluzotan (DG01279): 
Naratriptan (DG00837): 
Pardoprunox (DG01324): 
Pizotifen (DG00842): 
Sarizotan hydrochloride: 
Spiperone: 
Sunepitron hydrochloride: 
Tandospirone (DG01306): 
Vilazodone (DG00964): 
Vortioxetine (DG00965): 
Xaliproden (DG01008): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3350 (HTR1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3350 (HTR1A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3350 (HTR1A)
  Sensory system
   04742 Taste transduction
    3350 (HTR1A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3350 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P08908(Tclin)
UniProt: 
Position
5q12.3
AA seq 422 aa AA seqDB search
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccggctccctttgag
accggcggcaacactactggtatctccgacgtgaccgtcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttggagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttggtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtaacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcttgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggatcatggctacactatctattccacc
tttggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagacggtcaaaaaggtggagaagaccggagcggacacc
cgccatggagcatctcccgccccgcagcccaagaagagtgtgaatggagagtcggggagc
aggaactggaggctgggcgtggagagcaaggctgggggtgctctgtgcgccaatggcgcg
gtgaggcaaggtgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggtcctaccccttgtgcccccgcctct
ttcgagaggaaaaatgagcgcaacgccgaggcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgcccaccctg
ttgggcgccataatcaattggctgggctactccaactctctgcttaaccccgtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

DBGET integrated database retrieval system