KEGG   Homo sapiens (human): 3351Help
Entry
3351              CDS       T01001                                 

Gene name
HTR1B, 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction
Drug target
Almotriptan (DG00839): 
Alniditan dihydrochloride: 
Asenapine: 
Avitriptan fumarate: 
Cinitapride (DG01520): 
Eletriptan (DG00840): 
Elzasonan (DG01314): 
Ergometrine (DG00446): 
Frovatriptan (DG00841): 
Indorenate hydrochloride: 
Metergoline: 
Methylergometrine (DG00445): 
Methysergide (DG00835): 
Mianserin (DG00951): 
Naratriptan (DG00837): 
Pizotifen (DG00842): 
Rizatriptan (DG00838): 
Sumatriptan (DG00836): 
Zolmitriptan: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3351 (HTR1B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3351 (HTR1B)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3351 (HTR1B)
  Sensory system
   04742 Taste transduction
    3351 (HTR1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3351 (HTR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q13
AA seq 390 aa AA seqDB search
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccgggtgctcagtgcgctccaccgccgcccgcgggctccgagacctgggtt
cctcaagccaacttatcctctgctccctcccaaaactgcagcgccaaggactacatttac
caggactccatctccctaccctggaaagtactgctggttatgctattggcgctcatcacc
ttggccaccacgctctccaatgcctttgtgattgccacagtgtaccggacccggaaactg
cacaccccggctaactacctgatcgcctctctggcggtcaccgacctgcttgtgtccatc
ctggtgatgcccatcagcaccatgtacactgtcaccggccgctggacactgggccaggtg
gtctgtgacttctggctgtcgtcggacatcacttgttgcactgcctccatcctgcacctc
tgtgtcatcgccctggaccgctactgggccatcacggacgccgtggagtactcagctaaa
aggactcccaagagggcggcggtcatgatcgcgctggtgtgggtcttctccatctctatc
tcgctgccgcccttcttctggcgtcaggctaaggccgaagaggaggtgtcggaatgcgtg
gtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctacttcccc
accctgctcctcatcgccctctatggccgcatctacgtagaagcccgctcccggattttg
aaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataaccgactcc
cccgggtccacgtcctcggtcacctctattaactcgcgggttcccgacgtgcccagcgaa
tccggatctcctgtgtatgtgaaccaagtcaaagtgcgagtctccgacgccctgctggaa
aagaagaaactcatggccgctagggagcgcaaagccaccaagaccctagggatcattttg
ggagcctttattgtgtgttggctacccttcttcatcatctccctagtgatgcctatctgc
aaagatgcctgctggttccacctagccatctttgacttcttcacatggctgggctatctc
aactccctcatcaaccccataatctataccatgtccaatgaggactttaaacaagcattc
cataaactgatacgttttaagtgcacaagttga

DBGET integrated database retrieval system