KEGG   Homo sapiens (human): 3352Help
Entry
3352              CDS       T01001                                 

Gene name
HTR1D, 5-HT1D, HT1DA, HTR1DA, HTRL, RDC4
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction
Disease
H01703  
Eating Disorders
Drug target
Almotriptan (DG00839): 
Alniditan dihydrochloride: 
Avitriptan fumarate: 
Cinitapride (DG01520): 
Eletriptan (DG00840): 
Elzasonan (DG01314): 
Ergometrine (DG00446): 
Frovatriptan (DG00841): 
Indorenate hydrochloride: 
Metergoline: 
Methylergometrine (DG00445): 
Methysergide (DG00835): 
Mianserin (DG00951): 
Naratriptan (DG00837): 
Pizotifen (DG00842): 
Rizatriptan (DG00838): 
Sumatriptan (DG00836): 
Zolmitriptan: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3352 (HTR1D)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3352 (HTR1D)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3352 (HTR1D)
  Sensory system
   04742 Taste transduction
    3352 (HTR1D)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3352 (HTR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P28221(Tclin)
UniProt: 
Position
1p36.12
AA seq 377 aa AA seqDB search
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccccactgaaccagtcagcagaaggccttccccaggaggcctccaacagatccctg
aatgccacagaaacctcagaggcttgggatcccaggaccctccaggcgctcaagatctcc
cttgccgtggtcctttccgtcatcacactggccacagtcctctccaatgcctttgtactc
accaccatcttactcaccaggaagctccacacccctgccaactacctgattggctccctg
gccaccaccgacctcttggtttccatcttggtaatgcccatcagcatcgcctataccatc
acccacacctggaactttggccaaatcttgtgtgacatctggctgtcctctgacatcacg
tgctgcacagcctccatcctgcatctctgtgtcattgctctggacaggtactgggcaatc
acagatgccctggaatacagtaaacgcaggacggctggccacgcggccaccatgatcgcc
attgtctgggccatctccatctgcatctccatccccccgctcttctggcggcaggccaag
gcccaggaggagatgtcggactgtctggtgaacacctctcagatctcctacaccatctac
tccacctgtggggccttctacattccctcggtgttgctcatcatcctatatggccggatc
taccgggctgcccggaaccgcatcctgaatccaccctcactctatgggaagcgcttcacc
acggcccacctcatcacaggctctgccgggtcctcgctctgctcgctcaactccagcctc
catgaggggcactcgcactcggctggctcccctctctttttcaaccacgtgaaaatcaag
cttgctgacagtgccctggaacgcaagaggatttctgctgctcgagaaaggaaagccact
aaaatcctgggcatcattctgggggcctttatcatctgctggctgcccttcttcgtggtg
tctctggtcctccccatctgccgggactcctgctggatccacccggcgctctttgacttc
ttcacctggctaggctatttaaactccctcatcaatccaataatctacactgtgtttaat
gaagagtttcggcaagcttttcagaaaattgtccctttccggaaggcctcctag

DBGET integrated database retrieval system