KEGG   Homo sapiens (human): 3352Help
Entry
3352              CDS       T01001                                 

Gene name
HTR1D, 5-HT1D, HT1DA, HTR1DA, HTRL, RDC4
Definition
5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled
Orthology
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Methylergometrine: 
Ergometrine: 
Metergoline: 
Methysergide: 
Sumatriptan: 
Naratriptan: 
Zolmitriptan: 
Rizatriptan: 
Almotriptan: 
Eletriptan: 
Frovatriptan: 
Pizotifen: 
Asenapine: 
Mianserin: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.3-p34.3
AA seq 377 aa AA seqDB search
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccccactgaaccagtcagcagaaggccttccccaggaggcctccaacagatccctg
aatgccacagaaacctcagaggcttgggatcccaggaccctccaggcgctcaagatctcc
cttgccgtggtcctttccgtcatcacactggccacagtcctctccaatgcctttgtactc
accaccatcttactcaccaggaagctccacacccctgccaactacctgattggctccctg
gccaccaccgacctcttggtttccatcttggtaatgcccatcagcatcgcctataccatc
acccacacctggaactttggccaaatcttgtgtgacatctggctgtcctctgacatcacg
tgctgcacagcctccatcctgcatctctgtgtcattgctctggacaggtactgggcaatc
acagatgccctggaatacagtaaacgcaggacggctggccacgcggccaccatgatcgcc
attgtctgggccatctccatctgcatctccatccccccgctcttctggcggcaggccaag
gcccaggaggagatgtcggactgtctggtgaacacctctcagatctcctacaccatctac
tccacctgtggggccttctacattccctcggtgttgctcatcatcctatatggccggatc
taccgggctgcccggaaccgcatcctgaatccaccctcactctatgggaagcgcttcacc
acggcccacctcatcacaggctctgccgggtcctcgctctgctcgctcaactccagcctc
catgaggggcactcgcactcggctggctcccctctctttttcaaccacgtgaaaatcaag
cttgctgacagtgccctggaacgcaagaggatttctgctgctcgagaaaggaaagccact
aaaatcctgggcatcattctgggggcctttatcatctgctggctgcccttcttcgtggtg
tctctggtcctccccatctgccgggactcctgctggatccacccggcgctctttgacttc
ttcacctggctaggctatttaaactccctcatcaatccaataatctacactgtgtttaat
gaagagtttcggcaagcttttcagaaaattgtccctttccggaaggcctcctag

DBGET integrated database retrieval system