KEGG   Homo sapiens (human): 3354Help
Entry
3354              CDS       T01001                                 

Gene name
HTR1E, 5-HT1E
Definition
5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled
Orthology
K04153  
5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Methylergometrine: 
Ergometrine: 
Metergoline: 
Naratriptan: 
Pizotifen: 
Asenapine: 
Mianserin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3354 (HTR1E)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3354 (HTR1E)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3354 (HTR1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q14-q15
AA seq 365 aa AA seqDB search
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcacaaactgtaccacagaggccagcatggctataagacccaagaccatcact
gagaagatgctcatttgcatgactctggtggtcatcaccaccctcaccacgttgctgaac
ttggctgtgatcatggctattggcaccaccaagaagctccaccagcctgccaactaccta
atctgttctctggccgtgacggacctcctggtggcagtgctcgtcatgcccctgagcatc
atctacattgtcatggatcgctggaagcttgggtacttcctctgtgaggtgtggctgagt
gtggacatgacctgctgcacctgctccatcctccacctctgtgtcattgccctggacagg
tactgggccatcaccaatgctattgaatacgccaggaagaggacggccaagagggccgcg
ctgatgatccttaccgtctggaccatctccattttcatctccatgccccctctgttctgg
agaagccaccgccgcctaagccctccccctagtcagtgcaccatccagcacgaccatgtt
atctacaccatttactccacgctgggtgcgttttatatccccttgactttgatactgatt
ctctattaccggatttaccacgcggccaagagcctttaccagaaaaggggatcaagtcgg
cacttaagcaacagaagcacagatagccagaattcttttgcaagttgtaaacttacacag
actttctgtgtgtctgacttctccacctcagaccctaccacagagtttgaaaagttccat
gcctccatcaggatcccccccttcgacaatgatctagatcacccaggagaacgtcagcag
atctctagcaccagggaacggaaggcagcacgcatcctggggctgattctgggtgcattc
attttatcctggctgccatttttcatcaaagagttgattgtgggtctgagcatctacacc
gtgtcctcggaagtggccgactttctgacgtggctcggttatgtgaattctctgatcaac
cctctgctctatacgagttttaatgaagactttaagctggcttttaaaaagctcattaga
tgccgagagcatacttag

DBGET integrated database retrieval system