KEGG   Homo sapiens (human): 3354Help
Entry
3354              CDS       T01001                                 

Gene name
HTR1E, 5-HT1E
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    3354 (HTR1E)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3354 (HTR1E)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3354 (HTR1E)
  Sensory system
   04742 Taste transduction
    3354 (HTR1E)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3354 (HTR1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 3354
NCBI-ProteinID: NP_000856
OMIM: 182132
HGNC: 5291
Ensembl: ENSG00000168830
Vega: OTTHUMG00000015154
Pharos: P28566(Tchem)
UniProt: P28566
Position
6q14.3
AA seq 365 aa AA seqDB search
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcacaaactgtaccacagaggccagcatggctataagacccaagaccatcact
gagaagatgctcatttgcatgactctggtggtcatcaccaccctcaccacgttgctgaac
ttggctgtgatcatggctattggcaccaccaagaagctccaccagcctgccaactaccta
atctgttctctggccgtgacggacctcctggtggcagtgctcgtcatgcccctgagcatc
atctacattgtcatggatcgctggaagcttgggtacttcctctgtgaggtgtggctgagt
gtggacatgacctgctgcacctgctccatcctccacctctgtgtcattgccctggacagg
tactgggccatcaccaatgctattgaatacgccaggaagaggacggccaagagggccgcg
ctgatgatccttaccgtctggaccatctccattttcatctccatgccccctctgttctgg
agaagccaccgccgcctaagccctccccctagtcagtgcaccatccagcacgaccatgtt
atctacaccatttactccacgctgggtgcgttttatatccccttgactttgatactgatt
ctctattaccggatttaccacgcggccaagagcctttaccagaaaaggggatcaagtcgg
cacttaagcaacagaagcacagatagccagaattcttttgcaagttgtaaacttacacag
actttctgtgtgtctgacttctccacctcagaccctaccacagagtttgaaaagttccat
gcctccatcaggatcccccccttcgacaatgatctagatcacccaggagaacgtcagcag
atctctagcaccagggaacggaaggcagcacgcatcctggggctgattctgggtgcattc
attttatcctggctgccatttttcatcaaagagttgattgtgggtctgagcatctacacc
gtgtcctcggaagtggccgactttctgacgtggctcggttatgtgaattctctgatcaac
cctctgctctatacgagttttaatgaagactttaagctggcttttaaaaagctcattaga
tgccgagagcatacttag

DBGET integrated database retrieval system