KEGG   Homo sapiens (human): 3356Help
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled
Orthology
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Drug target
Ketanserin: 
Naftidrofuryl: 
Metergoline: 
Methysergide: 
Pizotifen: 
Dimetotiazine: 
Chlorpromazine: 
Levomepromazine: 
Pipamperone: 
Sertindole: 
Ziprasidone: 
Lurasidone: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Risperidone: 
Mosapramine: 
Zotepine: 
Aripiprazole: 
Paliperidone: 
Iloperidone: 
Opipramol: 
Mianserin: 
Trazodone: 
Nefazodone: 
Mirtazapine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3356 (HTR2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3356 (HTR2A)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    3356 (HTR2A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3356 (HTR2A)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3356 (HTR2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3356 (HTR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14-q21
AA seq 471 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

DBGET integrated database retrieval system