KEGG   Homo sapiens (human): 3356Help
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled
Orthology
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Drug target
Ketanserin: 
Naftidrofuryl: 
Metergoline: 
Methysergide: 
Pizotifen: 
Dimetotiazine: 
Chlorpromazine: 
Levomepromazine: 
Pipamperone: 
Sertindole: 
Ziprasidone: 
Lurasidone: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Asenapine: 
Risperidone: 
Mosapramine: 
Zotepine: 
Aripiprazole: 
Paliperidone: 
Iloperidone: 
Opipramol: 
Mianserin: 
Trazodone: 
Nefazodone: 
Mirtazapine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14-q21
AA seq 471 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

DBGET integrated database retrieval system