KEGG   Homo sapiens (human): 3356Help
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Disease
H01450  
Obsessive-compulsive disorder (OCD)
H01646  
Major depressive disorder
H01649  
Schizophrenia
Drug target
Adatanserin hydrochloride: 
Altanserin tartrate: 
Amesergide: 
Aripiprazole (DG00906): 
Asenapine: 
Atiprosin maleate: 
Blonanserin: 
Brexpiprazole: 
Chlorpromazine (DG00867): 
Cinanserin hydrochloride: 
Cinitapride (DG01520): 
Clozapine: 
Dimetotiazine (DG00843): 
Eplivanserin: 
Fananserin: 
Flibanserin: 
Glemanserin: 
Iloperidone: 
Ketanserin (DG00265): 
Levomepromazine (DG00868): 
Loxapine (DG00897): 
Lubazodone hydrochloride: 
Lurasidone: 
Metergoline: 
Methysergide (DG00835): 
Metrenperone: 
Mianserin (DG00951): 
Mirtazapine: 
Mosapramine (DG00905): 
Naftidrofuryl (DG00290): 
Nefazodone (DG00953): 
Nelotanserin: 
Olanzapine (DG00898): 
Opipramol (DG00930): 
Paliperidone (DG00907): 
Pelanserin hydrochloride: 
Perospirone hydrochloride hydrate: 
Pimavanserin: 
Pipamperone (DG00889): 
Pizotifen (DG00842): 
Pruvanserin (DG01278): 
Quetiapine (DG00899): 
Risperidone: 
Ritanserin: 
Sarpogrelate (DG01333): 
Sertindole: 
Setiptiline (DG01231): 
Setoperone: 
Spiperone: 
Temanogrel (DG01334): 
Trazodone (DG00952): 
Tropanserin hydrochloride: 
Xylamidine tosylate: 
Zicronapine (DG01539): 
Ziprasidone (DG00892): 
Zotepine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3356 (HTR2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3356 (HTR2A)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    3356 (HTR2A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3356 (HTR2A)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3356 (HTR2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3356 (HTR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P28223(Tclin)
UniProt: 
Position
13q14.2
AA seq 471 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

DBGET integrated database retrieval system