KEGG   Homo sapiens (human): 3357Help
Entry
3357              CDS       T01001                                 

Gene name
HTR2B, 5-HT(2B), 5-HT2B
Definition
5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Orthology
K04157  
5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Drug target
Metergoline: 
Dimetotiazine: 
Chlorpromazine: 
Levomepromazine: 
Ziprasidone: 
Lurasidone: 
Asenapine: 
Opipramol: 
Mianserin: 
Mirtazapine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3357 (HTR2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3357 (HTR2B)
 Cellular Processes
  Cell communication
   04540 Gap junction
    3357 (HTR2B)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3357 (HTR2B)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3357 (HTR2B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3357 (HTR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q36.3-q37.1
AA seq 481 aa AA seqDB search
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttca
ctggagaagaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaacc
gcatccatcatgcatctctgtgccatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcgatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccatgctttacagaagaaggcttacttagtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaacgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaaccctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacgcttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

DBGET integrated database retrieval system