KEGG   Homo sapiens (human): 336Help
Entry
336               CDS       T01001                                 

Gene name
APOA2, Apo-AII, ApoA-II, apoAII
Definition
apolipoprotein A-II
Orthology
K08758  
apolipoprotein A-II
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Disease
H00845  
Familial amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    336 (APOA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   336 (APOA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 100 aa AA seqDB search
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgcagcaactgtgctactcctcaccatctgcagccttgaaggagctttg
gttcggagacaggcaaaggagccatgtgtggagagcctggtttctcagtacttccagacc
gtgactgactatggcaaggacctgatggagaaggtcaagagcccagagcttcaggccgag
gccaagtcttactttgaaaagtcaaaggagcagctgacacccctgatcaagaaggctgga
acggaactggttaacttcttgagctatttcgtggaacttggaacacagcctgccacccag
tga

DBGET integrated database retrieval system