KEGG   Homo sapiens (human): 3360Help
Entry
3360              CDS       T01001                                 

Gene name
HTR4, 5-HT4, 5-HT4R
Definition
5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled
Orthology
K04160  
5-hydroxytryptamine receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metoclopramide: 
Cisapride: 
Prucalopride: 
Tegaserod: 
Metergoline: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31-q33
AA seq 388 aa AA seqDB search
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttctgaggagggtttcgggtcagtggagaaggtg
gtgctgctcacgtttctctcgacggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggaggtgttttgtcttgttcggacatctctggac
gtcctgctcacaacggcatcgatttttcacctgtgctgcatttctctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccatcagatccagatgttacaacgggcaggagcctcctccgagagcaggcct
cagtcggcagaccagcatagcactcatcgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggcaccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaatggatccacacatgtactaagggat
gcagtggagtgtggtggccagtgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctgctcagcccagtgacacttag

DBGET integrated database retrieval system