KEGG   Homo sapiens (human): 3361Help
Entry
3361              CDS       T01001                                 

Gene name
HTR5A, 5-HT5A
Definition
5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled
Orthology
K04161  
5-hydroxytryptamine receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metergoline: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q36.1
AA seq 357 aa AA seqDB search
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatttacctgtgaacctaacctccttttccctctccaccccctcccctttggagacc
aaccacagcctcggcaaagacgacctgcgccccagctcgcccctgctctcggtcttcgga
gtgcttattctcaccttgctgggctttctggtggcggcgacgttcgcctggaacctgctg
gtgctggcgaccatcctccgtgtacgcaccttccaccgcgtgccccacaacctggtggca
tccatggccgtctcggatgtcctggtggccgcgctggtcatgccgctgagcctggtgcac
gagctgtccgggcgccgctggcagctaggtcggaggctgtgccagctttggatcgcgtgc
gacgtgctttgctgcacggccagcatctggaacgtgacggccatagccctggaccgctac
tggtccatcacgcgccacatggaatacacgctccgcacccgcaagtgcgtctccaacgtc
atgatcgcgctcacctgggcactctccgctgtcatctctctggccccgctgctttttggc
tggggagagacgtactctgagggcagcgaggagtgccaggtaagccgcgagccttcctac
gccgtgttctccaccgtaggcgccttctacctgccgctctgtgtggtgctcttcgtgtac
tggaagatctacaaggctgccaagttccgcgtgggctccaggaagaccaatagcgtctca
cccatatccgaagctgtggaggtgaaggactctgccaaacagccccagatggtgttcacg
gtccgccacgccaccgtcaccttccagccagaaggggacacgtggcgggagcagaaggag
cagcgggccgccctcatggtgggcatcctcattggcgtgttcgtgctctgctggatcccc
ttctttctcaccgagctcatcagtcccctctgctcctgtgacatccccgccatctggaaa
agcatcttcctgtggcttggctactccaactccttctttaaccccctgatctatacggct
ttcaacaagaactacaacagcgccttcaagaacttcttttctaggcaacactga

DBGET integrated database retrieval system