KEGG   Homo sapiens (human): 3361Help
Entry
3361              CDS       T01001                                 

Gene name
HTR5A, 5-HT5A
Definition
5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled
Orthology
K04161  
5-hydroxytryptamine receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metergoline: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3361 (HTR5A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3361 (HTR5A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3361 (HTR5A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3361 (HTR5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q36.1
AA seq 357 aa AA seqDB search
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatttacctgtgaacctaacctccttttccctctccaccccctcccctttggagacc
aaccacagcctcggcaaagacgacctgcgccccagctcgcccctgctctcggtcttcgga
gtgcttattctcaccttgctgggctttctggtggcggcgacgttcgcctggaacctgctg
gtgctggcgaccatcctccgtgtacgcaccttccaccgcgtgccccacaacctggtggca
tccatggccgtctcggatgtcctggtggccgcgctggtcatgccgctgagcctggtgcac
gagctgtccgggcgccgctggcagctaggtcggaggctgtgccagctttggatcgcgtgc
gacgtgctttgctgcacggccagcatctggaacgtgacggccatagccctggaccgctac
tggtccatcacgcgccacatggaatacacgctccgcacccgcaagtgcgtctccaacgtc
atgatcgcgctcacctgggcactctccgctgtcatctctctggccccgctgctttttggc
tggggagagacgtactctgagggcagcgaggagtgccaggtaagccgcgagccttcctac
gccgtgttctccaccgtaggcgccttctacctgccgctctgtgtggtgctcttcgtgtac
tggaagatctacaaggctgccaagttccgcgtgggctccaggaagaccaatagcgtctca
cccatatccgaagctgtggaggtgaaggactctgccaaacagccccagatggtgttcacg
gtccgccacgccaccgtcaccttccagccagaaggggacacgtggcgggagcagaaggag
cagcgggccgccctcatggtgggcatcctcattggcgtgttcgtgctctgctggatcccc
ttctttctcaccgagctcatcagtcccctctgctcctgtgacatccccgccatctggaaa
agcatcttcctgtggcttggctactccaactccttctttaaccccctgatctatacggct
ttcaacaagaactacaacagcgccttcaagaacttcttttctaggcaacactga

DBGET integrated database retrieval system