KEGG   Homo sapiens (human): 3362Help
Entry
3362              CDS       T01001                                 

Gene name
HTR6, 5-HT6, 5-HT6R
Definition
5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled
Orthology
K04162  
5-hydroxytryptamine receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metergoline: 
Quetiapine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3362 (HTR6)
   04024 cAMP signaling pathway
    3362 (HTR6)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3362 (HTR6)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3362 (HTR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3362 (HTR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
1p36-p35
AA seq 440 aa AA seqDB search
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcccagagccgggcccaaccgccaatagcaccccggcctggggggcagggccgccg
tcggccccggggggcagcggctgggtggcggccgcgctgtgcgtggtcatcgcgctgacg
gcggcggccaactcgctgctgatcgcgctcatctgcactcagcccgcgctgcgcaacacg
tccaacttcttcctggtgtcgctcttcacgtctgacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgcgctgtacgggcgctgggtgctggcgcgcggcctctgcctg
ctctggaccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctcatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacgccc
ctgcgtgccctggccctagtcctgggcgcctggagcctcgccgctctcgcctccttcctg
cccctgctgctgggctggcacgagctgggccacgcacggccacccgtccctggccagtgc
cgcctgctggccagcctgccttttgtccttgtggcgtcgggcctcaccttcttcctgccc
tcgggtgccatatgcttcacctactgcaggatcctgctagctgcccgcaagcaggccgtg
caggtggcctccctcaccaccggcatggccagtcaggcctcggagacgctgcaggtgccc
aggaccccacgcccaggggtggagtctgctgacagcaggcgtctagccacgaagcacagc
aggaaggccctgaaggccagcctgacgctgggcatcctgctgggcatgttctttgtgacc
tggttgcccttctttgtggccaacatagtccaggccgtgtgcgactgcatctccccaggc
ctcttcgatgtcctcacatggctgggttactgtaacagcaccatgaaccccatcatctac
ccactcttcatgcgggacttcaagcgggcgctgggcaggttcctgccatgtccacgctgt
ccccgggagcgccaggccagcctggcctcgccatcactgcgcacctctcacagcggcccc
cggcccggccttagcctacagcaggtgctgccgctgcccctgccgccggactcagattcg
gactcagacgcaggctcaggcggctcctcgggcctgcggctcacggcccagctgctgctt
cctggcgaggccacccaggaccccccgctgcccaccagggccgctgccgccgtcaatttc
ttcaacatcgaccccgcggagcccgagctgcggccgcatccacttggcatccccacgaac
tga

DBGET integrated database retrieval system