KEGG   Homo sapiens (human): 3363Help
Entry
3363              CDS       T01001                                 

Gene name
HTR7, 5-HT7
Definition
5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
Orthology
K04163  
5-hydroxytryptamine receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metergoline: 
Lurasidone: 
Clozapine: 
Vortioxetine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3363 (HTR7)
   04020 Calcium signaling pathway
    3363 (HTR7)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3363 (HTR7)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3363 (HTR7)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3363 (HTR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21-q24
AA seq 445 aa AA seqDB search
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLQNADYCRKKGHDS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgcccggacctctacgggcacctccgctctttcctt
ctgccagaagtggggcgcgggctgcccgacttgagccccgacggtggcgccgacccggtc
gcgggctcctgggcgccgcacctgctgagcgaggtgacagccagcccggcgcccacctgg
gacgcgcccccggacaatgcctccggctgtggggaacagatcaactacggcagagtcgag
aaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcgggcaactgc
ctggtggtgatctccgtgtgcttcgtcaagaagctccgccagccctccaactacctgatc
gtgtccctggcgctggccgacctctcggtggctgtggcggtcatgcccttcgtcagcgtc
accgacctcatcgggggcaagtggatctttggacactttttctgtaatgtcttcatcgcc
atggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagcattgacagg
taccttgggatcacaaggcccctcacataccctgtgaggcagaatgggaaatgcatggcg
aagatgattctctccgtctggcttctctccgcctccatcaccttacctccactctttgga
tgggctcagaatgtaaatgatgataaggtgtgcttgatcagccaggactttggctatacg
atttactctaccgcagtggcattttatatccccatgtccgtcatgcttttcatgtactac
cagatttacaaggctgccaggaagagtgctgccaaacacaagtttcctggcttccctcga
gtggagccagacagcgtcatcgccctgaatggcatagtgaagctccagaaggaggtggaa
gagtgtgcaaacctttcgagactcctcaagcatgaaaggaaaaacatctccatctttaag
cgagaacagaaagcagccaccaccctggggatcatcgtcggggcctttaccgtgtgctgg
ctgccatttttcctcctctcgacagccagacccttcatctgtggcacttcctgcagctgc
atcccactgtgggtggagaggacatttctgtggctaggctatgcaaactctctcattaac
ccttttatatatgccttcttcaaccgggacctgaggaccacctatcgcagcctgctccag
tgccagtaccggaatatcaaccggaagctctcagctgcaggcatgcatgaagccctgaag
cttgctgagaggccagagagacctgagtttgtgctacaaaatgctgactactgtagaaaa
aaaggtcatgattcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system