KEGG   Homo sapiens (human): 3363Help
Entry
3363              CDS       T01001                                 

Gene name
HTR7, 5-HT7
Definition
5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
Orthology
K04163  
5-hydroxytryptamine receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Drug target
Metergoline: 
Lurasidone: 
Clozapine: 
Vortioxetine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21-q24
AA seq 445 aa AA seqDB search
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLQNADYCRKKGHDS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgcccggacctctacgggcacctccgctctttcctt
ctgccagaagtggggcgcgggctgcccgacttgagccccgacggtggcgccgacccggtc
gcgggctcctgggcgccgcacctgctgagcgaggtgacagccagcccggcgcccacctgg
gacgcgcccccggacaatgcctccggctgtggggaacagatcaactacggcagagtcgag
aaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcgggcaactgc
ctggtggtgatctccgtgtgcttcgtcaagaagctccgccagccctccaactacctgatc
gtgtccctggcgctggccgacctctcggtggctgtggcggtcatgcccttcgtcagcgtc
accgacctcatcgggggcaagtggatctttggacactttttctgtaatgtcttcatcgcc
atggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagcattgacagg
taccttgggatcacaaggcccctcacataccctgtgaggcagaatgggaaatgcatggcg
aagatgattctctccgtctggcttctctccgcctccatcaccttacctccactctttgga
tgggctcagaatgtaaatgatgataaggtgtgcttgatcagccaggactttggctatacg
atttactctaccgcagtggcattttatatccccatgtccgtcatgcttttcatgtactac
cagatttacaaggctgccaggaagagtgctgccaaacacaagtttcctggcttccctcga
gtggagccagacagcgtcatcgccctgaatggcatagtgaagctccagaaggaggtggaa
gagtgtgcaaacctttcgagactcctcaagcatgaaaggaaaaacatctccatctttaag
cgagaacagaaagcagccaccaccctggggatcatcgtcggggcctttaccgtgtgctgg
ctgccatttttcctcctctcgacagccagacccttcatctgtggcacttcctgcagctgc
atcccactgtgggtggagaggacatttctgtggctaggctatgcaaactctctcattaac
ccttttatatatgccttcttcaaccgggacctgaggaccacctatcgcagcctgctccag
tgccagtaccggaatatcaaccggaagctctcagctgcaggcatgcatgaagccctgaag
cttgctgagaggccagagagacctgagtttgtgctacaaaatgctgactactgtagaaaa
aaaggtcatgattcatga

DBGET integrated database retrieval system