KEGG   Homo sapiens (human): 337Help
Entry
337               CDS       T01001                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    337 (APOA4)
   04977 Vitamin digestion and absorption
    337 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 396 aa AA seqDB search
MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEV
SQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcgccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattgggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacctgcgagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcagcacgcaggccgagcagctgcggcgccagctgaccccctac
gcacagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgctgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctgaccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaaactgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagactctctccctccctgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system