KEGG   Homo sapiens (human): 3371Help
Entry
3371              CDS       T01001                                 

Gene name
TNC, 150-225, DFNA56, GMEM, GP, HXB, JI, TN, TN-C
Definition
tenascin C
Orthology
K06252  
tenascin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3371 (TNC)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3371 (TNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3371 (TNC)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3371 (TNC)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  3371 (TNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33
AA seq 2201 aa AA seqDB search
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGT
PYTVTLHGEVRGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWMATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6606 nt NT seq  +upstreamnt  +downstreamnt
atgggggccatgactcagctgttggcaggtgtctttcttgctttccttgccctcgctacc
gaaggtggggtcctcaagaaagtcatccggcacaagcgacagagtggggtgaacgccacc
ctgccagaagagaaccagccagtggtgtttaaccacgtttacaacatcaagctgccagtg
ggatcccagtgttcggtggatctggagtcagccagtggggagaaagacctggcaccgcct
tcagagcccagcgaaagctttcaggagcacacagtggatggggaaaaccagattgtcttc
acacatcgcatcaacatcccccgccgggcctgtggctgtgccgcagcccctgatgttaag
gagctgctgagcagactggaggagctggagaacctggtgtcttccctgagggagcaatgt
actgcaggagcaggctgctgtctccagcctgccacaggccgcttggacaccaggcccttc
tgtagcggtcggggcaacttcagcactgaaggatgtggctgtgtctgcgaacctggctgg
aaaggccccaactgctctgagcccgaatgtccaggcaactgtcaccttcgaggccggtgc
attgatgggcagtgcatctgtgacgacggcttcacgggcgaggactgcagccagctggct
tgccccagcgactgcaatgaccagggcaagtgcgtaaatggagtctgcatctgtttcgaa
ggctacgccggggctgactgcagccgtgaaatctgcccagtgccctgcagtgaggagcac
ggcacatgtgtagatggcttgtgtgtgtgccacgatggctttgcaggcgatgactgcaac
aagcctctgtgtctcaacaattgctacaaccgtggacgatgcgtggagaatgagtgcgtg
tgtgatgagggtttcacgggcgaagactgcagtgagctcatctgccccaatgactgcttc
gaccggggccgctgcatcaatggcacctgctactgcgaagaaggcttcacaggtgaagac
tgcgggaaacccacctgcccacatgcctgccacacccagggccggtgtgaggaggggcag
tgtgtatgtgatgagggctttgccggtgtggactgcagcgagaagaggtgtcctgctgac
tgtcacaatcgtggccgctgtgtagacgggcggtgtgagtgtgatgatggtttcactgga
gctgactgtggggagctcaagtgtcccaatggctgcagtggccatggccgctgtgtcaat
gggcagtgtgtgtgtgatgagggctatactggggaggactgcagccagctacggtgcccc
aatgactgtcacagtcggggccgctgtgtcgagggcaaatgtgtatgtgagcaaggcttc
aagggctatgactgcagtgacatgagctgccctaatgactgtcaccagcacggccgctgt
gtgaatggcatgtgtgtttgtgatgacggctacacaggggaagactgccgggatcgccaa
tgccccagggactgcagcaacaggggcctctgtgtggacggacagtgcgtctgtgaggac
ggcttcaccggccctgactgtgcagaactctcctgtccaaatgactgccatggccagggt
cgctgtgtgaatgggcagtgcgtgtgccatgaaggatttatgggcaaagactgcaaggag
caaagatgtcccagtgactgtcatggccagggccgctgcgtggacggccagtgcatctgc
cacgagggcttcacaggcctggactgtggccagcactcctgccccagtgactgcaacaac
ttaggacaatgcgtctcgggccgctgcatctgcaacgagggctacagcggagaagactgc
tcagaggtgtctcctcccaaagacctcgttgtgacagaagtgacggaagagacggtcaac
ctggcctgggacaatgagatgcgggtcacagagtaccttgtcgtgtacacgcccacccac
gagggtggtctggaaatgcagttccgtgtgcctggggaccagacgtccaccatcatccag
gagctggagcctggtgtggagtactttatccgtgtatttgccatcctggagaacaagaag
agcattcctgtcagcgccagggtggccacgtacttacctgcacctgaaggcctgaaattc
aagtccatcaaggagacatctgtggaagtggagtgggatcctctagacattgcttttgaa
acctgggagatcatcttccggaatatgaataaagaagatgagggagagatcaccaaaagc
ctgaggaggccagagacctcttaccggcaaactggtctagctcctgggcaagagtatgag
atatctctgcacatagtgaaaaacaatacccggggccctggcctgaagagggtgaccacc
acacgcttggatgcccccagccagatcgaggtgaaagatgtcacagacaccactgccttg
atcacctggttcaagcccctggctgagatcgatggcattgagctgacctacggcatcaaa
gacgtgccaggagaccgtaccaccatcgatctcacagaggacgagaaccagtactccatc
gggaacctgaagcctgacactgagtacgaggtgtccctcatctcccgcagaggtgacatg
tcaagcaacccagccaaagagaccttcacaacaggcctcgatgctcccaggaatcttcga
cgtgtttcccagacagataacagcatcaccctggaatggaggaatggcaaggcagctatt
gacagttacagaattaagtatgcccccatctctggaggggaccacgctgaggttgatgtt
ccaaagagccaacaagccacaaccaaaaccacactcacaggtctgaggccgggaactgaa
tatgggattggagtttctgctgtgaaggaagacaaggagagcaatccagcgaccatcaac
gcagccacagagttggacacgcccaaggaccttcaggtttctgaaactgcagagaccagc
ctgaccctgctctggaagacaccgttggccaaatttgaccgctaccgcctcaattacagt
ctccccacaggccagtgggtgggagtgcagcttccaagaaacaccacttcctatgtcctg
agaggcctggaaccaggacaggagtacaatgtcctcctgacagccgagaaaggcagacac
aagagcaagcccgcacgtgtgaaggcatccactgaacaagcccctgagctggaaaacctc
accgtgactgaggttggctgggatggcctcagactcaactggaccgcagctgaccaggcc
tatgagcactttatcattcaggtgcaggaggccaacaaggtggaggcagctcggaacctc
accgtgcctggcagccttcgggctgtggacataccgggcctcaaggctgctacgccttat
acagtctccatctatggggtgatccagggctatagaacaccagtgctctctgctgaggcc
tccacaggggaaactcccaatttgggagaggtcgtggtggccgaggtgggctgggatgcc
ctcaaactcaactggactgctccagaaggggcctatgagtactttttcattcaggtgcag
gaggctgacacagtagaggcagcccagaacctcaccgtcccaggaggactgaggtccaca
gacctgcctgggctcaaagcagccactcattataccatcaccatccgcggggtcactcag
gacttcagcacaacccctctctctgttgaagtcttgacagaggaggttccagatatggga
aacctcacagtgaccgaggttagctgggatgctctcagactgaactggaccacgccagat
ggaacctatgaccagtttactattcaggtccaggaggctgaccaggtggaagaggctcac
aatctcacggttcctggcagcctgcgttccatggaaatcccaggcctcagggctggcact
ccttacacagtcaccctgcacggcgaggtcaggggccacagcactcgaccccttgctgta
gaggtcgtcacagaggatctcccacagctgggagatttagccgtgtctgaggttggctgg
gatggcctcagactcaactggaccgcagctgacaatgcctatgagcactttgtcattcag
gtgcaggaggtcaacaaagtggaggcagcccagaacctcacgttgcctggcagcctcagg
gctgtggacatcccgggcctcgaggctgccacgccttatagagtctccatctatggggtg
atccggggctatagaacaccagtactctctgctgaggcctccacagccaaagaacctgaa
attggaaacttaaatgtttctgacataactcccgagagcttcaatctctcctggatggct
accgatgggatcttcgagacctttaccattgaaattattgattccaataggttgctggag
actgtggaatataatatctctggtgctgaacgaactgcccatatctcagggctaccccct
agtactgattttattgtctacctctctggacttgctcccagcatccggaccaaaaccatc
agtgccacagccacgacagaggccctgccccttctggaaaacctaaccatttccgacatt
aatccctacgggttcacagtttcctggatggcatcggagaatgcctttgacagctttcta
gtaacggtggtggattctgggaagctgctggacccccaggaattcacactttcaggaacc
cagaggaagctggagcttagaggcctcataactggcattggctatgaggttatggtctct
ggcttcacccaagggcatcaaaccaagcccttgagggctgagattgttacagaagccgaa
ccggaagttgacaaccttctggtttcagatgccaccccagacggtttccgtctgtcctgg
acagctgatgaaggggtcttcgacaattttgttctcaaaatcagagataccaaaaagcag
tctgagccactggaaataaccctacttgcccccgaacgtaccagggacataacaggtctc
agagaggctactgaatacgaaattgaactctatggaataagcaaaggaaggcgatcccag
acagtcagtgctatagcaacaacagccatgggctccccaaaggaagtcattttctcagac
atcactgaaaattcggctactgtcagctggagggcacccacagcccaagtggagagcttc
cggattacctatgtgcccattacaggaggtacaccctccatggtaactgtggacggaacc
aagactcagaccaggctggtgaaactcatacctggcgtggagtaccttgtcagcatcatc
gccatgaagggctttgaggaaagtgaacctgtctcagggtcattcaccacagctctggat
ggcccatctggcctggtgacagccaacatcactgactcagaagccttggccaggtggcag
ccagccattgccactgtggacagttatgtcatctcctacacaggcgagaaagtgccagaa
attacacgcacggtgtccgggaacacagtggagtatgctctgaccgacctcgagcctgcc
acggaatacacactgagaatctttgcagagaaagggccccagaagagctcaaccatcact
gccaagttcacaacagacctcgattctccaagagacttgactgctactgaggttcagtcg
gaaactgccctccttacctggcgacccccccgggcatcagtcaccggttacctgctggtc
tatgaatcagtggatggcacagtcaaggaagtcattgtgggtccagataccacctcctac
agcctggcagacctgagcccatccacccactacacagccaagatccaggcactcaatggg
cccctgaggagcaatatgatccagaccatcttcaccacaattggactcctgtaccccttc
cccaaggactgctcccaagcaatgctgaatggagacacgacctctggcctctacaccatt
tatctgaatggtgataaggctgaggcgctggaagtcttctgtgacatgacctctgatggg
ggtggatggattgtgttcctgagacgcaaaaacggacgcgagaacttctaccaaaactgg
aaggcatatgctgctggatttggggaccgcagagaagaattctggcttgggctggacaac
ctgaacaaaatcacagcccaggggcagtacgagctccgggtggacctgcgggaccatggg
gagacagcctttgctgtctatgacaagttcagcgtgggagatgccaagactcgctacaag
ctgaaggtggaggggtacagtgggacagcaggtgactccatggcctaccacaatggcaga
tccttctccacctttgacaaggacacagattcagccatcaccaactgtgctctgtcctac
aaaggggctttctggtacaggaactgtcaccgtgtcaacctgatggggagatatggggac
aataaccacagtcagggcgttaactggttccactggaagggccacgaacactcaatccag
tttgctgagatgaagctgagaccaagcaacttcagaaatcttgaaggcaggcgcaaacgg
gcataa

DBGET integrated database retrieval system