KEGG   Homo sapiens (human): 3376Help
Entry
3376              CDS       T01001                                 

Gene name
IARS, IARS1, ILERS, ILRS, IRS, PRO0785
Definition
isoleucyl-tRNA synthetase (EC:6.1.1.5)
Orthology
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21
AA seq 1262 aa AA seqDB search
MLQQVPENINFPAEEEKILEFWTEFNCFQECLKQSKHKPKFTFYDGPPFATGLPHYGHIL
AGTIKDIVTRYAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIRGPEDVAKMGITEYNNQC
RAIVMRYSAEWKSTVSRLGRWIDFDNDYKTLYPQFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVFVTFPLEEDETVSLVAWTTTPWTLPSNLAVCVNP
EMQYVKIKDVARGRLLILMEARLSALYKLESDYEILERFPGAYLKGKKYRPLFDYFLKCK
ENGAFTVLVDNYVKEEEGTGVVHQAPYFGAEDYRVCMDFNIIRKDSLPVCPVDASGCFTT
EVTDFAGQYVKDADKSIIRTLKEQGRLLVATTFTHSYPFCWRSDTPLIYKAVPSWFVRVE
NMVDQLLRNNDLCYWVPELVREKRFGNWLKDARDWTISRNRYWGTPIPLWVSDDFEEVVC
IGSVAELEELSGAKISDLHRESVDHLTIPSRCGKGSLHRISEVFDCWFESGSMPYAQVHY
PFENKREFEDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQK
MSKRKKNYPDPVSIIQKYGADALRLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAY
RFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVV
PRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELM
YQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKT
IPIKYPLKEIVVIHQDPEALKDIKSLEKYIIEELNVRKVTLSTDKNKYGIRLRAEPDHMV
LGKRLKGAFKAVMTSIKQLSSEELEQFQKTGTIVVEGHELHDEDIRLMYTFDQATGGTAQ
FEAHSDAQALVLLDVTPDQSMVDEGMAREVINRIQKLRKKCNLVPTDEITVYYKAKSEGT
YLNSVIESHTEFIFTTIKAPLKPYPVSPSDKVLIQEKTQLKGSELEITLTRGSSLPGPAC
AYVNLNICANGSEQGGVLLLENPKGDNRLDLLKLKSVVTSIFGVKNTELAVFHDETEIQN
QTDLLSLSGKTLCVTAGSAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPL
GQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTA
DF
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaacaagttccagaaaacataaattttcctgctgaagaagagaaaatcttggag
ttttggactgaatttaattgttttcaggaatgcttaaagcaatcaaaacataaaccaaaa
tttaccttctatgatggtcctccttttgcaactggactgcctcactatggacatatactt
gcgggtacaattaaagatatagttacaagatatgctcaccagagtgggtttcatgttgac
agaagatttggatgggattgccatggcttacctgtggaatatgaaattgataagacactg
ggaatcagaggaccagaggatgtggccaaaatggggattacagagtataacaatcagtgc
cgagcaattgtgatgagatattctgctgagtggaagtctactgttagcagacttggccga
tggattgactttgacaatgactataaaactctgtatccacaattcatggaatcagtctgg
tgggtcttcaaacaactctatgataaaggccttgtttatagaggtgtgaaagtcatgccc
ttctctacggcatgtaacactccactttccaacttcgagtcacaccagaattataaggat
gttcaagatccttcagtatttgtaactttccctttggaagaagatgaaactgtatcttta
gttgcttggacaaccactccctggactctacctagtaaccttgctgtgtgtgttaatcca
gaaatgcaatatgtgaaaattaaagatgttgccagaggacgattactcattttaatggaa
gccagattgtcagccctctataaattggagagtgactatgagatccttgaaagatttcct
ggtgcctatcttaaaggcaagaagtacaggcccctgtttgactatttcctgaagtgtaaa
gagaatggcgctttcactgtgcttgttgacaactatgtgaaggaagaagaaggcacaggg
gttgtccaccaagctccttacttcggtgctgaggactatcgggtctgtatggactttaac
attattcggaaagactcactccctgtttgccctgtggatgcttcaggctgcttcacaacg
gaggtgacagatttcgcaggacagtatgtgaaggatgctgacaaaagtatcatcaggact
ttgaaggaacaaggccgacttctggttgccaccaccttcactcacagctaccctttttgc
tggagatcagacactcctctaatttacaaagcagtgcccagctggtttgtgcgagtggag
aacatggtggaccagctcctaaggaacaatgacctgtgctactgggtcccagagttggta
cgagaaaaacgatttggaaattggctgaaagatgcacgtgactggacaatttccagaaac
agatactggggcacccccatcccactgtgggtcagcgatgactttgaggaggtggtatgc
attgggtcagtggcggaacttgaagaactgtcaggagcaaagatctcagatctccacaga
gagagtgttgaccacctgaccattccttcacgctgtgggaagggatccttgcaccgcatc
tctgaagtgtttgactgttggtttgagagtggcagcatgccctatgctcaggttcattac
ccgtttgaaaacaagagggagtttgaggatgcttttcctgcagatttcattgccgagggc
atcgaccaaaccagaggatggttttataccctgctggtgctggccacggccctctttgga
caaccgcctttcaagaacgtaattgtgaatgggcttgtcctggcaagtgatggccaaaaa
atgagcaaacggaaaaagaattatccagatccagtttccatcatccagaagtatggtgct
gatgccctcagattatatctgattaactcccctgtggtgagagcagaaaacctccgcttt
aaagaagagggtgtgcgggacgtccttaaggatgtactgctcccatggtacaatgcctat
cgcttcttaatccagaacgttctgaggctccagaaggaggaagaaatagaatttctctac
aatgagaacacggttagagaaagccccaacattacagaccggtggatcctgtccttcatg
cagtctctcattggcttctttgagactgaaatggcagcttataggctttatactgtggtg
cctcgcctggtcaagtttgtagatattctgaccaattggtatgttagaatgaaccgcaga
agattaaagggtgaaaatgggatggaggattgtgtcatggccctagaaaccttgtttagt
gttctgctttctctttgcagacttatggctccctacacaccttttctcactgaattgatg
taccagaatctaaaggtgctgattgaccctgtttctgttcaggacaaggacacactcagc
attcactacctcatgctgccccgtgttcgagaagaattgattgacaagaaaacagagagt
gcagtatctcagatgcagtctgtgattgaacttggaagagtgatcagagaccgaaaaact
attcccataaagtatcctttgaaagaaattgtggttatccatcaagatccagaagctctt
aaagatatcaagtctttggagaagtatatcattgaggaactcaatgttcgaaaagttaca
ctgtctacagataaaaacaagtatggcattcggctaagggcagaaccagatcacatggtc
ctggggaagcgtctgaagggagcctttaaggcagtgatgacgtccatcaagcagttgagc
agtgaggagctggagcagttccagaagactgggaccattgttgtggaaggccatgaattg
cacgatgaagacatccgcctcatgtacacctttgatcaggccacaggtgggactgcgcaa
tttgaagcacactcagatgctcaggctttggtcctcttagatgtcactcctgaccagtca
atggtagatgaaggaatggctcgggaagtcatcaatcgcatacagaaacttcgcaaaaag
tgcaatctggttccaactgatgaaatcacagtgtactataaagcaaagtctgaaggaaca
tatctgaatagtgttattgaaagccacacagagttcatatttaccaccataaaggctccc
ttgaaaccatatccagtttctccatcggataaagtccttattcaagaaaaaacacagttg
aagggatctgaactggaaattacactcaccagaggatcttcccttcctggtcctgcttgt
gcatatgtcaatcttaacatttgtgcaaatggcagtgaacaaggtggagtattgctcctg
gaaaatccaaaaggtgacaataggttggaccttttaaagctgaagagtgttgtcactagc
atttttggtgtgaaaaatacagagctggctgtcttccatgatgaaacagaaatacaaaac
caaactgacttactgagtcttagtggaaaaacactttgtgtgactgcaggatcggctccc
tctctgatcaacagttctagtactcttctttgtcagtatatcaacctacagctcctgaat
gcaaagccacaagagtgtttaatggggacagtgggcactctcctgcttgaaaacccactt
gggcagaatggactcacccaccaaggtcttctgtatgaagcagccaaggtgtttggcctt
cggagcaggaagctaaagctgtttctgaatgagacccaaacgcaggaaattacagaagac
atccccgtgaagactttgaatatgaagactgtgtatgtttctgtgttaccaacaacagca
gacttctag

DBGET integrated database retrieval system