KEGG   Homo sapiens (human): 3376Help
Entry
3376              CDS       T01001                                 

Gene name
IARS, IARS1, ILERS, ILRS, IRS, PRO0785
Definition
isoleucyl-tRNA synthetase (EC:6.1.1.5)
Orthology
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    3376 (IARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     3376 (IARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   3376 (IARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    3376 (IARS)
 Prokaryotic Type
   Other AARSs
    3376 (IARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21
AA seq 1262 aa AA seqDB search
MLQQVPENINFPAEEEKILEFWTEFNCFQECLKQSKHKPKFTFYDGPPFATGLPHYGHIL
AGTIKDIVTRYAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIRGPEDVAKMGITEYNNQC
RAIVMRYSAEWKSTVSRLGRWIDFDNDYKTLYPQFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVFVTFPLEEDETVSLVAWTTTPWTLPSNLAVCVNP
EMQYVKIKDVARGRLLILMEARLSALYKLESDYEILERFPGAYLKGKKYRPLFDYFLKCK
ENGAFTVLVDNYVKEEEGTGVVHQAPYFGAEDYRVCMDFNIIRKDSLPVCPVDASGCFTT
EVTDFAGQYVKDADKSIIRTLKEQGRLLVATTFTHSYPFCWRSDTPLIYKAVPSWFVRVE
NMVDQLLRNNDLCYWVPELVREKRFGNWLKDARDWTISRNRYWGTPIPLWVSDDFEEVVC
IGSVAELEELSGAKISDLHRESVDHLTIPSRCGKGSLHRISEVFDCWFESGSMPYAQVHY
PFENKREFEDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQK
MSKRKKNYPDPVSIIQKYGADALRLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAY
RFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVV
PRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELM
YQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKT
IPIKYPLKEIVVIHQDPEALKDIKSLEKYIIEELNVRKVTLSTDKNKYGIRLRAEPDHMV
LGKRLKGAFKAVMTSIKQLSSEELEQFQKTGTIVVEGHELHDEDIRLMYTFDQATGGTAQ
FEAHSDAQALVLLDVTPDQSMVDEGMAREVINRIQKLRKKCNLVPTDEITVYYKAKSEGT
YLNSVIESHTEFIFTTIKAPLKPYPVSPSDKVLIQEKTQLKGSELEITLTRGSSLPGPAC
AYVNLNICANGSEQGGVLLLENPKGDNRLDLLKLKSVVTSIFGVKNTELAVFHDETEIQN
QTDLLSLSGKTLCVTAGSAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPL
GQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTA
DF
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaacaagttccagaaaacataaattttcctgctgaagaagagaaaatcttggag
ttttggactgaatttaattgttttcaggaatgcttaaagcaatcaaaacataaaccaaaa
tttaccttctatgatggtcctccttttgcaactggactgcctcactatggacatatactt
gcgggtacaattaaagatatagttacaagatatgctcaccagagtgggtttcatgttgac
agaagatttggatgggattgccatggcttacctgtggaatatgaaattgataagacactg
ggaatcagaggaccagaggatgtggccaaaatggggattacagagtataacaatcagtgc
cgagcaattgtgatgagatattctgctgagtggaagtctactgttagcagacttggccga
tggattgactttgacaatgactataaaactctgtatccacaattcatggaatcagtctgg
tgggtcttcaaacaactctatgataaaggccttgtttatagaggtgtgaaagtcatgccc
ttctctacggcatgtaacactccactttccaacttcgagtcacaccagaattataaggat
gttcaagatccttcagtatttgtaactttccctttggaagaagatgaaactgtatcttta
gttgcttggacaaccactccctggactctacctagtaaccttgctgtgtgtgttaatcca
gaaatgcaatatgtgaaaattaaagatgttgccagaggacgattactcattttaatggaa
gccagattgtcagccctctataaattggagagtgactatgagatccttgaaagatttcct
ggtgcctatcttaaaggcaagaagtacaggcccctgtttgactatttcctgaagtgtaaa
gagaatggcgctttcactgtgcttgttgacaactatgtgaaggaagaagaaggcacaggg
gttgtccaccaagctccttacttcggtgctgaggactatcgggtctgtatggactttaac
attattcggaaagactcactccctgtttgccctgtggatgcttcaggctgcttcacaacg
gaggtgacagatttcgcaggacagtatgtgaaggatgctgacaaaagtatcatcaggact
ttgaaggaacaaggccgacttctggttgccaccaccttcactcacagctaccctttttgc
tggagatcagacactcctctaatttacaaagcagtgcccagctggtttgtgcgagtggag
aacatggtggaccagctcctaaggaacaatgacctgtgctactgggtcccagagttggta
cgagaaaaacgatttggaaattggctgaaagatgcacgtgactggacaatttccagaaac
agatactggggcacccccatcccactgtgggtcagcgatgactttgaggaggtggtatgc
attgggtcagtggcggaacttgaagaactgtcaggagcaaagatctcagatctccacaga
gagagtgttgaccacctgaccattccttcacgctgtgggaagggatccttgcaccgcatc
tctgaagtgtttgactgttggtttgagagtggcagcatgccctatgctcaggttcattac
ccgtttgaaaacaagagggagtttgaggatgcttttcctgcagatttcattgccgagggc
atcgaccaaaccagaggatggttttataccctgctggtgctggccacggccctctttgga
caaccgcctttcaagaacgtaattgtgaatgggcttgtcctggcaagtgatggccaaaaa
atgagcaaacggaaaaagaattatccagatccagtttccatcatccagaagtatggtgct
gatgccctcagattatatctgattaactcccctgtggtgagagcagaaaacctccgcttt
aaagaagagggtgtgcgggacgtccttaaggatgtactgctcccatggtacaatgcctat
cgcttcttaatccagaacgttctgaggctccagaaggaggaagaaatagaatttctctac
aatgagaacacggttagagaaagccccaacattacagaccggtggatcctgtccttcatg
cagtctctcattggcttctttgagactgaaatggcagcttataggctttatactgtggtg
cctcgcctggtcaagtttgtagatattctgaccaattggtatgttagaatgaaccgcaga
agattaaagggtgaaaatgggatggaggattgtgtcatggccctagaaaccttgtttagt
gttctgctttctctttgcagacttatggctccctacacaccttttctcactgaattgatg
taccagaatctaaaggtgctgattgaccctgtttctgttcaggacaaggacacactcagc
attcactacctcatgctgccccgtgttcgagaagaattgattgacaagaaaacagagagt
gcagtatctcagatgcagtctgtgattgaacttggaagagtgatcagagaccgaaaaact
attcccataaagtatcctttgaaagaaattgtggttatccatcaagatccagaagctctt
aaagatatcaagtctttggagaagtatatcattgaggaactcaatgttcgaaaagttaca
ctgtctacagataaaaacaagtatggcattcggctaagggcagaaccagatcacatggtc
ctggggaagcgtctgaagggagcctttaaggcagtgatgacgtccatcaagcagttgagc
agtgaggagctggagcagttccagaagactgggaccattgttgtggaaggccatgaattg
cacgatgaagacatccgcctcatgtacacctttgatcaggccacaggtgggactgcgcaa
tttgaagcacactcagatgctcaggctttggtcctcttagatgtcactcctgaccagtca
atggtagatgaaggaatggctcgggaagtcatcaatcgcatacagaaacttcgcaaaaag
tgcaatctggttccaactgatgaaatcacagtgtactataaagcaaagtctgaaggaaca
tatctgaatagtgttattgaaagccacacagagttcatatttaccaccataaaggctccc
ttgaaaccatatccagtttctccatcggataaagtccttattcaagaaaaaacacagttg
aagggatctgaactggaaattacactcaccagaggatcttcccttcctggtcctgcttgt
gcatatgtcaatcttaacatttgtgcaaatggcagtgaacaaggtggagtattgctcctg
gaaaatccaaaaggtgacaataggttggaccttttaaagctgaagagtgttgtcactagc
atttttggtgtgaaaaatacagagctggctgtcttccatgatgaaacagaaatacaaaac
caaactgacttactgagtcttagtggaaaaacactttgtgtgactgcaggatcggctccc
tctctgatcaacagttctagtactcttctttgtcagtatatcaacctacagctcctgaat
gcaaagccacaagagtgtttaatggggacagtgggcactctcctgcttgaaaacccactt
gggcagaatggactcacccaccaaggtcttctgtatgaagcagccaaggtgtttggcctt
cggagcaggaagctaaagctgtttctgaatgagacccaaacgcaggaaattacagaagac
atccccgtgaagactttgaatatgaagactgtgtatgtttctgtgttaccaacaacagca
gacttctag

DBGET integrated database retrieval system