KEGG   Homo sapiens (human): 338Help
Entry
338               CDS       T01001                                 

Gene name
APOB, FLDB, LDLCQ4
Definition
apolipoprotein B
Orthology
K14462  
apolipoprotein B
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Disease
H00155  
Hypercholesterolemia
H01270  
Familial hypobetalipoproteinemia (FHBL)
Drug target
Mipomersen: 
Class
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p24-p23
AA seq 4563 aa AA seqDB search
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
DHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHV
EKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTAS
LKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLN
SHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGA
SMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSN
DMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ
GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALW
GEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGT
WKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDAL
EMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL
DDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRV
NLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQH
LAGKLKQHIEAIDVRVLLDQLGTTISFERINDVLEHVKHFVINLIGDFEVAEKINAFRAK
VHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELP
QKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTR
DRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL
VEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIK
IPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYS
ILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKIN
PLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQ
LTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEG
THESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRF
PLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGE
ANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKN
KHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHD
ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQS
DIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKN
MEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHK
LSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDD
IWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLD
IAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFS
IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFA
LNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDL
NAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE
DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFS
KWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
LYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGT
YQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKH
KLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEM
KFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQY
IMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV
EQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELT
IIL
NT seq 13692 nt NT seq  +upstreamnt  +downstreamnt
atggacccgccgaggcccgcgctgctggcgctgctggcgctgcctgcgctgctgctgctg
ctgctggcgggcgccagggccgaagaggaaatgctggaaaatgtcagcctggtctgtcca
aaagatgcgacccgattcaagcacctccggaagtacacatacaactatgaggctgagagt
tccagtggagtccctgggactgctgattcaagaagtgccaccaggatcaactgcaaggtt
gagctggaggttccccagctctgcagcttcatcctgaagaccagccagtgcaccctgaaa
gaggtgtatggcttcaaccctgagggcaaagccttgctgaagaaaaccaagaactctgag
gagtttgctgcagccatgtccaggtatgagctcaagctggccattccagaagggaagcag
gttttcctttacccggagaaagatgaacctacttacatcctgaacatcaagaggggcatc
atttctgccctcctggttcccccagagacagaagaagccaagcaagtgttgtttctggat
accgtgtatggaaactgctccactcactttaccgtcaagacgaggaagggcaatgtggca
acagaaatatccactgaaagagacctggggcagtgtgatcgcttcaagcccatccgcaca
ggcatcagcccacttgctctcatcaaaggcatgacccgccccttgtcaactctgatcagc
agcagccagtcctgtcagtacacactggacgctaagaggaagcatgtggcagaagccatc
tgcaaggagcaacacctcttcctgcctttctcctacaagaataagtatgggatggtagca
caagtgacacagactttgaaacttgaagacacaccaaagatcaacagccgcttctttggt
gaaggtactaagaagatgggcctcgcatttgagagcaccaaatccacatcacctccaaag
caggccgaagctgttttgaagactctccaggaactgaaaaaactaaccatctctgagcaa
aatatccagagagctaatctcttcaataagctggttactgagctgagaggcctcagtgat
gaagcagtcacatctctcttgccacagctgattgaggtgtccagccccatcactttacaa
gccttggttcagtgtggacagcctcagtgctccactcacatcctccagtggctgaaacgt
gtgcatgccaacccccttctgatagatgtggtcacctacctggtggccctgatccccgag
ccctcagcacagcagctgcgagagatcttcaacatggcgagggatcagcgcagccgagcc
accttgtatgcgctgagccacgcggtcaacaactatcataagacaaaccctacagggacc
caggagctgctggacattgctaattacctgatggaacagattcaagatgactgcactggg
gatgaagattacacctatttgattctgcgggtcattggaaatatgggccaaaccatggag
cagttaactccagaactcaagtcttcaatcctgaaatgtgtccaaagtacaaagccatca
ctgatgatccagaaagctgccatccaggctctgcggaaaatggagcctaaagacaaggac
caggaggttcttcttcagactttccttgatgatgcttctccgggagataagcgactggct
gcctatcttatgttgatgaggagtccttcacaggcagatattaacaaaattgtccaaatt
ctaccatgggaacagaatgagcaagtgaagaactttgtggcttcccatattgccaatatc
ttgaactcagaagaattggatatccaagatctgaaaaagttagtgaaagaagctctgaaa
gaatctcaacttccaactgtcatggacttcagaaaattctctcggaactatcaactctac
aaatctgtttctcttccatcacttgacccagcctcagccaaaatagaagggaatcttata
tttgatccaaataactaccttcctaaagaaagcatgctgaaaactaccctcactgccttt
ggatttgcttcagctgacctcatcgagattggcttggaaggaaaaggctttgagccaaca
ttggaagctctttttgggaagcaaggatttttcccagacagtgtcaacaaagctttgtac
tgggttaatggtcaagttcctgatggtgtctctaaggtcttagtggaccactttggctat
accaaagatgataaacatgagcaggatatggtaaatggaataatgctcagtgttgagaag
ctgattaaagatttgaaatccaaagaagtcccggaagccagagcctacctccgcatcttg
ggagaggagcttggttttgccagtctccatgacctccagctcctgggaaagctgcttctg
atgggtgcccgcactctgcaggggatcccccagatgattggagaggtcatcaggaagggc
tcaaagaatgacttttttcttcactacatcttcatggagaatgcctttgaactccccact
ggagctggattacagttgcaaatatcttcatctggagtcattgctcccggagccaaggct
ggagtaaaactggaagtagccaacatgcaggctgaactggtggcaaaaccctccgtgtct
gtggagtttgtgacaaatatgggcatcatcattccggacttcgctaggagtggggtccag
atgaacaccaacttcttccacgagtcgggtctggaggctcatgttgccctaaaagctggg
aagctgaagtttatcattccttccccaaagagaccagtcaagctgctcagtggaggcaac
acattacatttggtctctaccaccaaaacggaggtgatcccacctctcattgagaacagg
cagtcctggtcagtttgcaagcaagtctttcctggcctgaattactgcacctcaggcgct
tactccaacgccagctccacagactccgcctcctactatccgctgaccggggacaccaga
ttagagctggaactgaggcctacaggagagattgagcagtattctgtcagcgcaacctat
gagctccagagagaggacagagccttggtggataccctgaagtttgtaactcaagcagaa
ggtgcgaagcagactgaggctaccatgacattcaaatataatcggcagagtatgaccttg
tccagtgaagtccaaattccggattttgatgttgacctcggaacaatcctcagagttaat
gatgaatctactgagggcaaaacgtcttacagactcaccctggacattcagaacaagaaa
attactgaggtcgccctcatgggccacctaagttgtgacacaaaggaagaaagaaaaatc
aagggtgttatttccataccccgtttgcaagcagaagccagaagtgagatcctcgcccac
tggtcgcctgccaaactgcttctccaaatggactcatctgctacagcttatggctccaca
gtttccaagagggtggcatggcattatgatgaagagaagattgaatttgaatggaacaca
ggcaccaatgtagataccaaaaaaatgacttccaatttccctgtggatctctccgattat
cctaagagcttgcatatgtatgctaatagactcctggatcacagagtccctcaaacagac
atgactttccggcacgtgggttccaaattaatagttgcaatgagctcatggcttcagaag
gcatctgggagtcttccttatacccagactttgcaagaccacctcaatagcctgaaggag
ttcaacctccagaacatgggattgccagacttccacatcccagaaaacctcttcttaaaa
agcgatggccgggtcaaatataccttgaacaagaacagtttgaaaattgagattcctttg
ccttttggtggcaaatcctccagagatctaaagatgttagagactgttaggacaccagcc
ctccacttcaagtctgtgggattccatctgccatctcgagagttccaagtccctactttt
accattcccaagttgtatcaactgcaagtgcctctcctgggtgttctagacctctccacg
aatgtctacagcaacttgtacaactggtccgcctcctacagtggtggcaacaccagcaca
gaccatttcagccttcgggctcgttaccacatgaaggctgactctgtggttgacctgctt
tcctacaatgtgcaaggatctggagaaacaacatatgaccacaagaatacgttcacacta
tcatgtgatgggtctctacgccacaaatttctagattcgaatatcaaattcagtcatgta
gaaaaacttggaaacaacccagtctcaaaaggtttactaatattcgatgcatctagttcc
tggggaccacagatgtctgcttcagttcatttggactccaaaaagaaacagcatttgttt
gtcaaagaagtcaagattgatgggcagttcagagtctcttcgttctatgctaaaggcaca
tatggcctgtcttgtcagagggatcctaacactggccggctcaatggagagtccaacctg
aggtttaactcctcctacctccaaggcaccaaccagataacaggaagatatgaagatgga
accctctccctcacctccacctctgatctgcaaagtggcatcattaaaaatactgcttcc
ctaaagtatgagaactacgagctgactttaaaatctgacaccaatgggaagtataagaac
tttgccacttctaacaagatggatatgaccttctctaagcaaaatgcactgctgcgttct
gaatatcaggctgattacgagtcattgaggttcttcagcctgctttctggatcactaaat
tcccatggtcttgagttaaatgctgacatcttaggcactgacaaaattaatagtggtgct
cacaaggcgacactaaggattggccaagatggaatatctaccagtgcaacgaccaacttg
aagtgtagtctcctggtgctggagaatgagctgaatgcagagcttggcctctctggggca
tctatgaaattaacaacaaatggccgcttcagggaacacaatgcaaaattcagtctggat
gggaaagccgccctcacagagctatcactgggaagtgcttatcaggccatgattctgggt
gtcgacagcaaaaacattttcaacttcaaggtcagtcaagaaggacttaagctctcaaat
gacatgatgggctcatatgctgaaatgaaatttgaccacacaaacagtctgaacattgca
ggcttatcactggacttctcttcaaaacttgacaacatttacagctctgacaagttttat
aagcaaactgttaatttacagctacagccctattctctggtaactactttaaacagtgac
ctgaaatacaatgctctggatctcaccaacaatgggaaactacggctagaacccctgaag
ctgcatgtggctggtaacctaaaaggagcctaccaaaataatgaaataaaacacatctat
gccatctcttctgctgccttatcagcaagctataaagcagacactgttgctaaggttcag
ggtgtggagtttagccatcggctcaacacagacatcgctgggctggcttcagccattgac
atgagcacaaactataattcagactcactgcatttcagcaatgtcttccgttctgtaatg
gccccgtttaccatgaccatcgatgcacatacaaatggcaatgggaaactcgctctctgg
ggagaacatactgggcagctgtatagcaaattcctgttgaaagcagaacctctggcattt
actttctctcatgattacaaaggctccacaagtcatcatctcgtgtctaggaaaagcatc
agtgcagctcttgaacacaaagtcagtgccctgcttactccagctgagcagacaggcacc
tggaaactcaagacccaatttaacaacaatgaatacagccaggacttggatgcttacaac
actaaagataaaattggcgtggagcttactggacgaactctggctgacctaactctacta
gactccccaattaaagtgccacttttactcagtgagcccatcaatatcattgatgcttta
gagatgagagatgccgttgagaagccccaagaatttacaattgttgcttttgtaaagtat
gataaaaaccaagatgttcactccattaacctcccattttttgagaccttgcaagaatat
tttgagaggaatcgacaaaccattatagttgtactggaaaacgtacagagaaacctgaag
cacatcaatattgatcaatttgtaagaaaatacagagcagccctgggaaaactcccacag
caagctaatgattatctgaattcattcaattgggagagacaagtttcacatgccaaggag
aaactgactgctctcacaaaaaagtatagaattacagaaaatgatatacaaattgcatta
gatgatgccaaaatcaactttaatgaaaaactatctcaactgcagacatatatgatacaa
tttgatcagtatattaaagatagttatgatttacatgatttgaaaatagctattgctaat
attattgatgaaatcattgaaaaattaaaaagtcttgatgagcactatcatatccgtgta
aatttagtaaaaacaatccatgatctacatttgtttattgaaaatattgattttaacaaa
agtggaagtagtactgcatcctggattcaaaatgtggatactaagtaccaaatcagaatc
cagatacaagaaaaactgcagcagcttaagagacacatacagaatatagacatccagcac
ctagctggaaagttaaaacaacacattgaggctattgatgttagagtgcttttagatcaa
ttgggaactacaatttcatttgaaagaataaatgacgttcttgagcatgtcaaacacttt
gttataaatcttattggggattttgaagtagctgagaaaatcaatgccttcagagccaaa
gtccatgagttaatcgagaggtatgaagtagaccaacaaatccaggttttaatggataaa
ttagtagagttggcccaccaatacaagttgaaggagactattcagaagctaagcaatgtc
ctacaacaagttaagataaaagattactttgagaaattggttggatttattgatgatgct
gtcaagaagcttaatgaattatcttttaaaacattcattgaagatgttaacaaattcctt
gacatgttgataaagaaattaaagtcatttgattaccaccagtttgtagatgaaaccaat
gacaaaatccgtgaggtgactcagagactcaatggtgaaattcaggctctggaactacca
caaaaagctgaagcattaaaactgtttttagaggaaaccaaggccacagttgcagtgtat
ctggaaagcctacaggacaccaaaataaccttaatcatcaattggttacaggaggcttta
agttcagcatctttggctcacatgaaggccaaattccgagagaccctagaagatacacga
gaccgaatgtatcaaatggacattcagcaggaacttcaacgatacctgtctctggtaggc
caggtttatagcacacttgtcacctacatttctgattggtggactcttgctgctaagaac
cttactgactttgcagagcaatattctatccaagattgggctaaacgtatgaaagcattg
gtagagcaagggttcactgttcctgaaatcaagaccatccttgggaccatgcctgccttt
gaagtcagtcttcaggctcttcagaaagctaccttccagacacctgattttatagtcccc
ctaacagatttgaggattccatcagttcagataaacttcaaagacttaaaaaatataaaa
atcccatccaggttttccacaccagaatttaccatccttaacaccttccacattccttcc
tttacaattgactttgtagaaatgaaagtaaagatcatcagaaccattgaccagatgctg
aacagtgagctgcagtggcccgttccagatatatatctcagggatctgaaggtggaggac
attcctctagcgagaatcaccctgccagacttccgtttaccagaaatcgcaattccagaa
ttcataatcccaactctcaaccttaatgattttcaagttcctgaccttcacataccagaa
ttccagcttccccacatctcacacacaattgaagtacctacttttggcaagctatacagt
attctgaaaatccaatctcctcttttcacattagatgcaaatgctgacatagggaatgga
accacctcagcaaacgaagcaggtatcgcagcttccatcactgccaaaggagagtccaaa
ttagaagttctcaattttgattttcaagcaaatgcacaactctcaaaccctaagattaat
ccgctggctctgaaggagtcagtgaagttctccagcaagtacctgagaacggagcatggg
agtgaaatgctgttttttggaaatgctattgagggaaaatcaaacacagtggcaagttta
cacacagaaaaaaatacactggagcttagtaatggagtgattgtcaagataaacaatcag
cttaccctggatagcaacactaaatacttccacaaattgaacatccccaaactggacttc
tctagtcaggctgacctgcgcaacgagatcaagacactgttgaaagctggccacatagca
tggacttcttctggaaaagggtcatggaaatgggcctgccccagattctcagatgaggga
acacatgaatcacaaattagtttcaccatagaaggacccctcacttcctttggactgtcc
aataagatcaatagcaaacacctaagagtaaaccaaaacttggtttatgaatctggctcc
ctcaacttttctaaacttgaaattcaatcacaagtcgattcccagcatgtgggccacagt
gttctaactgctaaaggcatggcactgtttggagaagggaaggcagagtttactgggagg
catgatgctcatttaaatggaaaggttattggaactttgaaaaattctcttttcttttca
gcccagccatttgagatcacggcatccacaaacaatgaagggaatttgaaagttcgtttt
ccattaaggttaacagggaagatagacttcctgaataactatgcactgtttctgagtccc
agtgcccagcaagcaagttggcaagtaagtgctaggttcaatcagtataagtacaaccaa
aatttctctgctggaaacaacgagaacattatggaggcccatgtaggaataaatggagaa
gcaaatctggatttcttaaacattcctttaacaattcctgaaatgcgtctaccttacaca
ataatcacaactcctccactgaaagatttctctctatgggaaaaaacaggcttgaaggaa
ttcttgaaaacgacaaagcaatcatttgatttaagtgtaaaagctcagtataagaaaaac
aaacacaggcattccatcacaaatcctttggctgtgctttgtgagtttatcagtcagagc
atcaaatcctttgacaggcattttgaaaaaaacagaaacaatgcattagattttgtcacc
aaatcctataatgaaacaaaaattaagtttgataagtacaaagctgaaaaatctcacgac
gagctccccaggacctttcaaattcctggatacactgttccagttgtcaatgttgaagtg
tctccattcaccatagagatgtcggcattcggctatgtgttcccaaaagcagtcagcatg
cctagtttctccatcctaggttctgacgtccgtgtgccttcatacacattaatcctgcca
tcattagagctgccagtccttcatgtccctagaaatctcaagctttctcttccagatttc
aaggaattgtgtaccataagccatatttttattcctgccatgggcaatattacctatgat
ttctcctttaaatcaagtgtcatcacactgaataccaatgctgaactttttaaccagtca
gatattgttgctcatctcctttcttcatcttcatctgtcattgatgcactgcagtacaaa
ttagagggcaccacaagattgacaagaaaaaggggattgaagttagccacagctctgtct
ctgagcaacaaatttgtggagggtagtcataacagtactgtgagcttaaccacgaaaaat
atggaagtgtcagtggcaacaaccacaaaagcccaaattccaattttgagaatgaatttc
aagcaagaacttaatggaaataccaagtcaaaacctactgtctcttcctccatggaattt
aagtatgatttcaattcttcaatgctgtactctaccgctaaaggagcagttgaccacaag
cttagcttggaaagcctcacctcttacttttccattgagtcatctaccaaaggagatgtc
aagggttcggttctttctcgggaatattcaggaactattgctagtgaggccaacacttac
ttgaattccaagagcacacggtcttcagtgaagctgcagggcacttccaaaattgatgat
atctggaaccttgaagtaaaagaaaattttgctggagaagccacactccaacgcatatat
tccctctgggagcacagtacgaaaaaccacttacagctagagggcctctttttcaccaac
ggagaacatacaagcaaagccaccctggaactctctccatggcaaatgtcagctcttgtt
caggtccatgcaagtcagcccagttccttccatgatttccctgaccttggccaggaagtg
gccctgaatgctaacactaagaaccagaagatcagatggaaaaatgaagtccggattcat
tctgggtctttccagagccaggtcgagctttccaatgaccaagaaaaggcacaccttgac
attgcaggatccttagaaggacacctaaggttcctcaaaaatatcatcctaccagtctat
gacaagagcttatgggatttcctaaagctggatgtaaccaccagcattggtaggagacag
catcttcgtgtttcaactgcctttgtgtacaccaaaaaccccaatggctattcattctcc
atccctgtaaaagttttggctgataaattcattattcctgggctgaaactaaatgatcta
aattcagttcttgtcatgcctacgttccatgtcccatttacagatcttcaggttccatcg
tgcaaacttgacttcagagaaatacaaatctataagaagctgagaacttcatcatttgcc
ctcaacctaccaacactccccgaggtaaaattccctgaagttgatgtgttaacaaaatat
tctcaaccagaagactccttgattcccttttttgagataaccgtgcctgaatctcagtta
actgtgtcccagttcacgcttccaaaaagtgtttcagatggcattgctgctttggatcta
aatgcagtagccaacaagatcgcagactttgagttgcccaccatcatcgtgcctgagcag
accattgagattccctccattaagttctctgtacctgctggaattgtcattccttccttt
caagcactgactgcacgctttgaggtagactctcccgtgtataatgccacttggagtgcc
agtttgaaaaacaaagcagattatgttgaaacagtcctggattccacatgcagctcaacc
gtacagttcctagaatatgaactaaatgttttgggaacacacaaaatcgaagatggtacg
ttagcctctaagactaaaggaacatttgcacaccgtgacttcagtgcagaatatgaagaa
gatggcaaatatgaaggacttcaggaatgggaaggaaaagcgcacctcaatatcaaaagc
ccagcgttcaccgatctccatctgcgctaccagaaagacaagaaaggcatctccacctca
gcagcctccccagccgtaggcaccgtgggcatggatatggatgaagatgacgacttttct
aaatggaacttctactacagccctcagtcctctccagataaaaaactcaccatattcaaa
actgagttgagggtccgggaatctgatgaggaaactcagatcaaagttaattgggaagaa
gaggcagcttctggcttgctaacctctctgaaagacaacgtgcccaaggccacaggggtc
ctttatgattatgtcaacaagtaccactgggaacacacagggctcaccctgagagaagtg
tcttcaaagctgagaagaaatctgcagaacaatgctgagtgggtttatcaaggggccatt
aggcaaattgatgatatcgacgtgaggttccagaaagcagccagtggcaccactgggacc
taccaagagtggaaggacaaggcccagaatctgtaccaggaactgttgactcaggaaggc
caagccagtttccagggactcaaggataacgtgtttgatggcttggtacgagttactcaa
gaattccatatgaaagtcaagcatctgattgactcactcattgattttctgaacttcccc
agattccagtttccggggaaacctgggatatacactagggaggaactttgcactatgttc
ataagggaggtagggacggtactgtcccaggtatattcgaaagtccataatggttcagaa
atactgttttcctatttccaagacctagtgattacacttcctttcgagttaaggaaacat
aaactaatagatgtaatctcgatgtatagggaactgttgaaagatttatcaaaagaagcc
caagaggtatttaaagccattcagtctctcaagaccacagaggtgctacgtaatcttcag
gaccttttacaattcattttccaactaatagaagataacattaaacagctgaaagagatg
aaatttacttatcttattaattatatccaagatgagatcaacacaatcttcagtgattat
atcccatatgtttttaaattgttgaaagaaaacctatgccttaatcttcataagttcaat
gaatttattcaaaacgagcttcaggaagcttctcaagagttacagcagatccatcaatac
attatggcccttcgtgaagaatattttgatccaagtatagttggctggacagtgaaatat
tatgaacttgaagaaaagatagtcagtctgatcaagaacctgttagttgctcttaaggac
ttccattctgaatatattgtcagtgcctctaactttacttcccaactctcaagtcaagtt
gagcaatttctgcacagaaatattcaggaatatcttagcatccttaccgatccagatgga
aaagggaaagagaagattgcagagctttctgccactgctcaggaaataattaaaagccag
gccattgcgacgaagaaaataatttctgattaccaccagcagtttagatataaactgcaa
gatttttcagaccaactctctgattactatgaaaaatttattgctgaatccaaaagattg
attgacctgtccattcaaaactaccacacatttctgatatacatcacggagttactgaaa
aagctgcaatcaaccacagtcatgaacccctacatgaagcttgctccaggagaacttact
atcatcctctaa

DBGET integrated database retrieval system