KEGG   Homo sapiens (human): 338376Help
Entry
338376            CDS       T01001                                 

Gene name
IFNE, IFN-E, IFNE1, IFNT1, INFE1, PRO655
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04622  RIG-I-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    338376 (IFNE)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    338376 (IFNE)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    338376 (IFNE)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   338376 (IFNE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon DUF1027
Motif
Other DBs
NCBI-GeneID: 338376
NCBI-ProteinID: NP_795372
OMIM: 615223
HGNC: 18163
Ensembl: ENSG00000184995
Vega: OTTHUMG00000019672
Pharos: Q86WN2(Tbio)
UniProt: Q86WN2
Position
9p21.3
AA seq 208 aa AA seqDB search
MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVF
SLTEKLSKQGRPLNDMKQELTTEFRSPR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattatcaagcacttctttggaactgtgttggtgctgctggcctctaccactatcttc
tctctagatttgaaactgattatcttccagcaaagacaagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaaccttgtcaattcagcagtgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacacactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaaccacacggagaaattcctcattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcacctgtgcctgggccattgtccaagtagaaatcagccgatgtctgttctttgtgttc
agtctcacagaaaaactgagcaaacaaggaagacccttgaacgacatgaagcaagagctt
actacagagtttagaagcccgaggtag

DBGET integrated database retrieval system