KEGG   Homo sapiens (human): 338382Help
Entry
338382            CDS       T01001                                 

Gene name
RAB7B, RAB7
Definition
RAB7B, member RAS oncogene family
Orthology
K07898  
Ras-related protein Rab-7B
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Salmonella infection
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    338382 (RAB7B)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    338382 (RAB7B)
   05146 Amoebiasis
    338382 (RAB7B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    338382 (RAB7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q32
AA seq 199 aa AA seqDB search
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccggaagaaggtggacctgaaactcattatcgtcggagccattggtgtggga
aagacctccctccttcaccaatatgtgcacaagacgttttatgaggaataccagaccaca
ctgggggccagcatcctctccaagattatcatattgggtgacacaactttgaagttacag
atctgggacacgggcggtcaggagcggttccgctccatggtgtccacgttctacaagggc
tccgatggctgcatcctagcttttgatgtcaccgacctggagtcttttgaagccctggat
atctggcggggtgatgtcctggccaagattgtccccatggagcagtcctaccccatggtg
ttgttggggaacaagatcgatctggcagaccggaaggtaccccaggaagtagctcaaggc
tggtgtagagagaaagatattccttactttgaagtcagtgccaagaatgacatcaatgtg
gtgcaagcgtttgagatgctggccagtagggctctgtcgaggtaccagagcatcttagaa
aatcacctcacagaatccatcaagctctcgccagaccagtcaaggagcagatgctgctga

DBGET integrated database retrieval system