KEGG   Homo sapiens (human): 338382Help
Entry
338382            CDS       T01001                                 

Gene name
RAB7B, RAB7
Definition
RAB7B, member RAS oncogene family
Orthology
K07898  
Ras-related protein Rab-7B
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Salmonella infection
Amoebiasis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
1q32
AA seq 199 aa AA seqDB search
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccggaagaaggtggacctgaaactcattatcgtcggagccattggtgtggga
aagacctccctccttcaccaatatgtgcacaagacgttttatgaggaataccagaccaca
ctgggggccagcatcctctccaagattatcatattgggtgacacaactttgaagttacag
atctgggacacgggcggtcaggagcggttccgctccatggtgtccacgttctacaagggc
tccgatggctgcatcctagcttttgatgtcaccgacctggagtcttttgaagccctggat
atctggcggggtgatgtcctggccaagattgtccccatggagcagtcctaccccatggtg
ttgttggggaacaagatcgatctggcagaccggaaggtaccccaggaagtagctcaaggc
tggtgtagagagaaagatattccttactttgaagtcagtgccaagaatgacatcaatgtg
gtgcaagcgtttgagatgctggccagtagggctctgtcgaggtaccagagcatcttagaa
aatcacctcacagaatccatcaagctctcgccagaccagtcaaggagcagatgctgctga

DBGET integrated database retrieval system