KEGG   Homo sapiens (human): 3385Help
Entry
3385              CDS       T01001                                 

Gene name
ICAM3, CD50, CDW50, ICAM-R
Definition
intercellular adhesion molecule 3
Orthology
K06486  
intercellular adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3385 (ICAM3)
Cellular antigens [BR:hsa04090]
 Proteins
  3385 (ICAM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 547 aa AA seqDB search
MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSS
EKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERV
ELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLAS
RDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVD
CTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARADQEGAREIVCNVTLGG
ERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVPAAAPGQPAQL
QLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIE
AGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMG
EEPSRAE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatggtaccatccgtgttgtggcccagggcctgctggactctgctggtctgc
tgtctgctgaccccaggtgtccaggggcaggagttccttttgcgggtggagccccagaac
cctgtgctctctgctggagggtccctgtttgtgaactgcagtactgattgtcccagctct
gagaaaatcgccttggagacgtccctatcaaaggagctggtggccagtggcatgggctgg
gcagccttcaatctcagcaacgtgactggcaacagtcggatcctctgctcagtgtactgc
aatggctctcagataacaggctcctctaacatcaccgtgtacaggctcccggagcgtgtg
gagctggcacccctgcctccttggcagccggtgggccagaacttcaccctgcgctgccaa
gtggaggatgggtcgccccggaccagcctcacggtggtgctgcttcgctgggaggaggag
ctgagccggcagcccgcagtggaggagccagcggaggtcactgccactgtgctggccagc
agagacgaccacggagcccctttctcatgccgcacagaactggacatgcagccccagggg
ctgggactgttcgtgaacacctcagccccccgccagctccgaacctttgtcctgcccgtg
acccccccgcgcctcgtggccccccggttcttggaggtggaaacgtcgtggccggtggac
tgcaccctagacgggctttttccagcctcagaggcccaggtctacctggcgctgggggac
cagatgctgaatgcgacagtcatgaaccacggggacacgctaacggccacagccacagcc
acggcgcgcgcggatcaggagggtgcccgggagatcgtctgcaacgtgaccctagggggc
gagagacgggaggcccgggagaacttgacggtctttagcttcctaggacccattgtgaac
ctcagcgagcccaccgcccatgaggggtccacagtgaccgtgagttgcatggctggggct
cgagtccaggtcacgctggacggagttccggccgcggccccggggcagccagctcaactt
cagctaaatgctaccgagagtgacgacggacgcagcttcttctgcagtgccactctcgag
gtggacggcgagttcttgcacaggaacagtagcgtccagctgcgagtcctgtatggtccc
aaaattgaccgagccacatgcccccagcacttgaaatggaaagataaaacgagacacgtc
ctgcagtgccaagccaggggcaacccgtaccccgagctgcggtgtttgaaggaaggctcc
agccgggaggtgccggtggggatcccgttcttcgtcaacgtaacacataatggtacttat
cagtgccaagcgtccagctcacgaggcaaatacaccctggtcgtggtgatggacattgag
gctgggagctcccactttgtccccgtcttcgtggcggtgttactgaccctgggcgtggtg
actatcgtactggccttaatgtacgtcttcagggagcaccaacggagcggcagttaccat
gttagggaggagagcacctatctgcccctcacgtctatgcagccgacagaagcaatgggg
gaagaaccgtccagagctgagtga

DBGET integrated database retrieval system