KEGG   Homo sapiens (human): 3385Help
Entry
3385              CDS       T01001                                 

Gene name
ICAM3, CD50, CDW50, ICAM-R
Definition
(RefSeq) intercellular adhesion molecule 3
  KO
K06486  intercellular adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3385 (ICAM3)
CD molecules [BR:hsa04090]
 Proteins
  3385 (ICAM3)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  3385 (ICAM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2
Motif
Other DBs
NCBI-GeneID: 3385
NCBI-ProteinID: NP_002153
OMIM: 146631
HGNC: 5346
Ensembl: ENSG00000076662
Vega: OTTHUMG00000180410
Pharos: P32942(Tbio)
UniProt: P32942 A0A024R7C1
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 547 aa AA seqDB search
MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSS
EKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERV
ELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLAS
RDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVD
CTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARADQEGAREIVCNVTLGG
ERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVPAAAPGQPAQL
QLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIE
AGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMG
EEPSRAE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatggtaccatccgtgttgtggcccagggcctgctggactctgctggtctgc
tgtctgctgaccccaggtgtccaggggcaggagttccttttgcgggtggagccccagaac
cctgtgctctctgctggagggtccctgtttgtgaactgcagtactgattgtcccagctct
gagaaaatcgccttggagacgtccctatcaaaggagctggtggccagtggcatgggctgg
gcagccttcaatctcagcaacgtgactggcaacagtcggatcctctgctcagtgtactgc
aatggctctcagataacaggctcctctaacatcaccgtgtacaggctcccggagcgtgtg
gagctggcacccctgcctccttggcagccggtgggccagaacttcaccctgcgctgccaa
gtggaggatgggtcgccccggaccagcctcacggtggtgctgcttcgctgggaggaggag
ctgagccggcagcccgcagtggaggagccagcggaggtcactgccactgtgctggccagc
agagacgaccacggagcccctttctcatgccgcacagaactggacatgcagccccagggg
ctgggactgttcgtgaacacctcagccccccgccagctccgaacctttgtcctgcccgtg
acccccccgcgcctcgtggccccccggttcttggaggtggaaacgtcgtggccggtggac
tgcaccctagacgggctttttccagcctcagaggcccaggtctacctggcgctgggggac
cagatgctgaatgcgacagtcatgaaccacggggacacgctaacggccacagccacagcc
acggcgcgcgcggatcaggagggtgcccgggagatcgtctgcaacgtgaccctagggggc
gagagacgggaggcccgggagaacttgacggtctttagcttcctaggacccattgtgaac
ctcagcgagcccaccgcccatgaggggtccacagtgaccgtgagttgcatggctggggct
cgagtccaggtcacgctggacggagttccggccgcggccccggggcagccagctcaactt
cagctaaatgctaccgagagtgacgacggacgcagcttcttctgcagtgccactctcgag
gtggacggcgagttcttgcacaggaacagtagcgtccagctgcgagtcctgtatggtccc
aaaattgaccgagccacatgcccccagcacttgaaatggaaagataaaacgagacacgtc
ctgcagtgccaagccaggggcaacccgtaccccgagctgcggtgtttgaaggaaggctcc
agccgggaggtgccggtggggatcccgttcttcgtcaacgtaacacataatggtacttat
cagtgccaagcgtccagctcacgaggcaaatacaccctggtcgtggtgatggacattgag
gctgggagctcccactttgtccccgtcttcgtggcggtgttactgaccctgggcgtggtg
actatcgtactggccttaatgtacgtcttcagggagcaccaacggagcggcagttaccat
gttagggaggagagcacctatctgcccctcacgtctatgcagccgacagaagcaatgggg
gaagaaccgtccagagctgagtga

DBGET integrated database retrieval system