KEGG   Homo sapiens (human): 338674Help
Entry
338674            CDS       T01001                                 

Gene name
OR5F1, OR11-10
Definition
(RefSeq) olfactory receptor family 5 subfamily F member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    338674 (OR5F1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    338674 (OR5F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 338674
NCBI-ProteinID: NP_003688
OMIM: 608492
HGNC: 8343
Ensembl: ENSG00000149133
Vega: OTTHUMG00000166825
Pharos: O95221(Tdark)
UniProt: O95221
Position
11q12.1
AA seq 314 aa AA seqDB search
MTRKNYTSLTEFVLLGLADTLELQIILFLFFLVIYTLTVLGNLGMILLIRIDSQLHTPMY
FFLANLSFVDVCNSTTITPKMLADLLSEKKTISFAGCFLQMYFFISLATTECILFGLMAY
DRYAAICRPLLYSLIMSRTVYLKMAAGAFAAGLLNFMVNTSHVSSLSFCDSNVIHHFFCD
SPPLFKLSCSDTILKESISSILAGVNIVGTLLVILSSYSYVLFSIFSMHSGEGRHRAFST
CASHLTAIILFYATCIYTYLRPSSSYSLNQDKVASVFYTVVIPMLNPLIYSLRSKEVKKA
LANVISRKRTSSFL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaaaaaattatacctcactgactgagttcgtcctattgggattagcagacacg
ctggagctacagattatcctctttttgttttttcttgtgatttatacacttacagtactg
ggaaatctcgggatgatcctcttaatcaggatcgattcccagcttcacacacccatgtat
ttcttcctggctaacctgtcctttgtggacgtttgtaactcaactaccatcaccccaaag
atgctggcagatttattatcagagaagaaaaccatctcttttgctggctgcttcctacag
atgtacttctttatctccctggcgacaaccgaatgcatcctctttgggttaatggcctat
gacaggtatgcggccatatgtcgcccgctgctttactccttgatcatgtccaggaccgtc
tacctaaaaatggcagccggggcttttgctgcagggttgctgaacttcatggtcaacaca
agccatgtcagcagcttgtcattctgtgactccaatgtcatccatcacttcttctgtgac
agtcccccacttttcaagctctcttgttctgacacaatcctgaaagaaagcataagttct
attttggctggtgtgaatattgtggggactctgcttgtcatcctctcctcctactcctac
gttctcttctccattttttctatgcattcgggggaggggaggcacagagctttctccacg
tgtgcctctcacctgacagccataattctgttctatgccacctgcatctatacttacctg
agacctagttccagctactccctgaatcaggacaaagtggcttctgtgttctacacagtg
gtgattcccatgttgaatcctctgatctacagcctcaggagtaaggaagtaaagaaggct
ttagcgaatgtaattagcaggaaaaggacctcttcctttctgtga

DBGET integrated database retrieval system