KEGG   Homo sapiens (human): 338675Help
Entry
338675            CDS       T01001                                 

Gene name
OR5AP2, OR9J1
Definition
(RefSeq) olfactory receptor family 5 subfamily AP member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    338675 (OR5AP2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    338675 (OR5AP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 LPAM_2
Motif
Other DBs
NCBI-GeneID: 338675
NCBI-ProteinID: NP_001002925
HGNC: 15258
Ensembl: ENSG00000172464
Vega: OTTHUMG00000166865
Pharos: Q8NGF4(Tdark)
UniProt: Q8NGF4
Position
11q12.1
AA seq 316 aa AA seqDB search
MRLMKEVRGRNQTEVTEFLLLGLSDNPDLQGVLFALFLLIYMANMVGNLGMIVLIKIDLC
LHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAENKAISFHGCAAQFYFFGSFLGTECFL
LAMMAYDRYAAIWNPLLYPVLVSGRICFLLIATSFLAGCGNAAIHTGMTFRLSFCGSNRI
NHFYCDTPPLLKLSCSDTHFNGIVIMAFSSFIVISCVMIVLISYLCIFIAVLKMPSLEGR
HKAFSTCASYLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKN
KDVKKALKKILWKHIL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagacttatgaaagaggttcgaggcagaaatcaaacagaagtaacagaatttctcctc
ttaggactttccgacaatccagatctacaaggagtcctctttgcattgtttctgttgatc
tatatggcaaacatggtgggcaatttggggatgattgtattgattaagattgatctctgt
ctccacacccccatgtatttctttctcagtagcctctcttttgtagatgcctcttactct
tcttccgtcactcccaagatgctggtgaacctcatggctgagaataaggccatttctttt
catggatgtgctgcccagttctacttctttggctccttcctggggactgagtgcttcctg
ttggccatgatggcatatgaccgctatgcagccatttggaaccccctgctctacccagtt
ctcgtgtctgggagaatttgctttttgctaatagctacctccttcttagcaggttgtgga
aatgcagccatacatacagggatgacttttaggttgtccttttgtggttctaataggatc
aaccatttctactgtgacaccccgccactgctcaaactctcttgctctgatacccacttc
aatggcattgtgatcatggcattctcaagttttattgtcatcagctgtgttatgattgtc
ctcatttcctacctgtgtatcttcattgccgtcttgaagatgccttcgttagagggcagg
cacaaagccttctccacctgtgcctcttacctcatggctgtcaccatattctttggaaca
atcctcttcatgtacttgcgccctacatctagctactcaatggagcaagacaaggttgtc
tctgtcttttatacagtaataatccctgtgctaaatcccctcatctatagtttaaaaaat
aaggatgtaaaaaaggccctaaagaagatcttatggaaacacatcttgtag

DBGET integrated database retrieval system