KEGG   Homo sapiens (human): 338755Help
Entry
338755            CDS       T01001                                 

Gene name
OR2AG2, OR11-76, OR2AG2P
Definition
(RefSeq) olfactory receptor family 2 subfamily AG member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    338755 (OR2AG2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    338755 (OR2AG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 338755
NCBI-ProteinID: NP_001004490
HGNC: 15143
Ensembl: ENSG00000188124
Vega: OTTHUMG00000165868
Pharos: A6NM03(Tdark)
UniProt: A6NM03 A0A126GWC6
Position
11p15.4
AA seq 316 aa AA seqDB search
MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMY
LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAY
DRYVAICHPLKYMTLMSPRVCWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCE
IPPLLKLACADTSRYELIIYVTGVTFLLLPISAIVASYTLVLFTVLRMPSNEGRKKALVT
CSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
LRRVLGKYILLAHSTL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagctccggaactccaccttgggaagcggcttcatcttggtggggattctgaatgac
agtgggtctcctgaactgctctatgctacatttacaatcctatacatgttggcactgacc
agcaatggtctgctgctcctggccatcaccatagaagcccggctccacatgcccatgtac
ctcctgcttgggcagctctctctcatggacctcctgttcacatctgttgtcactcccaag
gcccttgcggactttctgcgcagagaaaacactatctcctttggaggctgtgcacttcag
atgttcctggcactgacaatgggtagcgctgaggacctcctactggccttcatggcctat
gacaggtatgtggccatttgtcatcctctgaaatacatgaccctcatgagcccaagagtc
tgctggatcatggtggccacatcctggatcctggcatccctgattgctataggacatacc
atgtacactatgcacctccctttctgtgtgtcctgggaaatcaggcatctgctctgtgag
atcccacccttgctgaagttggcctgtgctgatacctccaggtatgagcttataatatac
gtgacaggtgtgactttcctcttgctccccatttctgccattgtggcctcctacacacta
gtcctattcactgtgcttcgtatgccatcaaatgaggggaggaagaaagcccttgtcacc
tgctcttcccacctgattgtggtcgggatgttctatggagctgccacattcatgtatgtc
ttgcccagttccttccacagccccaaacaagacaacatcatctctgttttctacacaatt
gtcactccagccctgaatccactcatctacagcctgaggaataaggaggtcatgcgggcc
ttgaggagggtcctgggaaaatacatactgctggcacattccacgctctag

DBGET integrated database retrieval system