KEGG   Homo sapiens (human): 339184Help
Entry
339184            CDS       T01001                                 

Gene name
CCDC144NL
Definition
(RefSeq) coiled-coil domain containing 144 family, N-terminal like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 339184
NCBI-ProteinID: NP_001004306
HGNC: 33735
Ensembl: ENSG00000205212
Vega: OTTHUMG00000132271
Pharos: Q6NUI1(Tdark)
UniProt: Q6NUI1
Position
17p11.2
AA seq 221 aa AA seqDB search
MASWGGEKRGGAGGSPKPAVYATRKTPSVGSQEDQWYLDYPGDQWSLGFSYSWWKNSVGS
ESKHGEGALDQLQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLV
PEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTG
AVGGHPRGPGEYCHLHEQRVHHHIFARGKRKGKNHVSNVVR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctggggtggagaaaagcggggaggggctggggggtctccgaagccggcagtc
tacgccacgaggaagacccctagtgttgggagccaggaggaccagtggtacttggactac
ccgggggaccagtggtccttgggcttctcctacagctggtggaagaacagcgtcggcagc
gagagcaagcacggtgagggcgccttagaccagctccagcacgatgtccgcctggaagat
cttggcgagctccacagagctgcccggtcgggcgacgtccctggggtggagcacgtcttg
gctcctggagacactggcgtggacaagagggataggaagaagagcattcagcaactagtt
cctgaatataaggaaaaacagacacctgaaagtcttcctcaaaataacaatccagctgct
ccaagccaggctgaaggaggagaaggaggagtcgcctgtggtacggtggagcagatgacg
tggctctgcagcttgcctcatgcagttggtggtggagatggagaccacagctcgactgga
gcggtaggagggcacccacgggggcctggagagtattgtcatctgcatgagcaaagggtt
catcaccacatctttgcaagaggaaaaagaaaggggaagaatcatgtgtctaatgttgta
aggtaa

DBGET integrated database retrieval system