KEGG   Homo sapiens (human): 339221Help
Entry
339221            CDS       T01001                                 

Gene name
ENPP7, ALK-SMase, E-NPP_7, NPP-7
Definition
ectonucleotide pyrophosphatase/phosphodiesterase 7 (EC:3.1.4.12)
Orthology
K12354  
ectonucleotide pyrophosphatase/phosphodiesterase family member 7 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 458 aa AA seqDB search
MRGPAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARD
GVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWD
NGSVPIWITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVM
AWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLN
LIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDAL
KDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDM
DMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALP
PDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcccggccgtcctcctcactgtggctctggccacgctcctggctcccggggcc
ggagcaccggtacaaagtcagggctcccagaacaagctgctcctggtgtccttcgacggc
ttccgctggaactacgaccaggacgtggacacccccaacctggacgccatggcccgagac
ggggtgaaggcacgctacatgacccccgcctttgtcaccatgaccagcccctgccacttc
accctggtcaccggcaaatatatcgagaaccacggggtggttcacaacatgtactacaac
accaccagcaaggtgaagctgccctaccacgccacgctgggcatccagaggtggtgggac
aacggcagcgtgcccatctggatcacagcccagaggcagggcctgagggctggctccttc
ttctacccgggcgggaacgtcacctaccaaggggtggctgtgacgcggagccggaaagaa
ggcatcgcacacaactacaaaaatgagacggagtggagagcgaacatcgacacagtgatg
gcgtggttcacagaggaggacctggatctggtcacactctacttcggggagccggactcc
acgggccacaggtacggccccgagtccccggagaggagggagatggtgcggcaggtggac
cggaccgtgggctacctccgggagagcatcgcgcgcaaccacctcacagaccgcctcaac
ctgatcatcacatccgaccacggcatgacgaccgtggacaaacgggctggcgacctggtt
gaattccacaagttccccaacttcaccttccgggacatcgagtttgagctcctggactac
ggaccaaacgggatgctgctccctaaagaagggaggctggagaaggtgtacgatgccctc
aaggacgcccaccccaagctccacgtctacaagaaggaggcgttccccgaggccttccac
tacgccaacaaccccagggtcacacccctgctgatgtacagcgaccttggctacgtcatc
catgggagaattaacgtccagttcaacaatggggagcacggctttgacaacaaggacatg
gacatgaagaccatcttccgcgctgtgggccctagcttcagggcgggcctggaggtggag
ccctttgagagcgtccacgtgtacgagctcatgtgccggctgctgggcatcgtgcccgag
gccaacgatgggcacctagctactctgctgcccatgctgcacacagaatctgctcttccg
cctgatggaaggcctactctcctgcccaagggaagatctgctctcccgcccagcagcagg
cccctcctcgtgatgggactgctggggaccgtgattcttctgtctgaggtcgcataa

DBGET integrated database retrieval system